close

SimulationCraft 815-02

for World of Warcraft 8.2.0 PTR (wow build level 30329)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-05-15 Real Procs Per Minute data removed from Killing Machine.
Killing Machine rppm 4.50 0.00
2019-03-12 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2018-05-02 Incorrect spell level for Icicle buff.
Icicles spell_level 78.00 80.00
2017-11-08 Incorrect spell level for Ignite.
Ignite spell_level 78.00 99.00
2017-11-06 Incorrect spell level for Icicle.
Icicle spell_level 78.00 80.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-01-07 Incorrect Maelstrom generation value for Chain Lightning Overloads.
Fulmination (effect#6) base_value 2.00 3.00

Table of Contents

Raid Summary

 

Created with Highcharts 4.2.3 Damage per Second44,863 (11.86%)43,250 (7.84%)42,762 (6.62%)41,733 (4.06%)41,730 (4.05%)41,043 (2.33%)40,830 (1.80%)40,713 (1.51%)40,107visionslucid dreamsblood of the enemyfocusing irisunbound forcepurification protocolworldveinripple in spacebasebaseMaximum: 45,041.9Upper quartile: 40,917.4Mean: 40,106.9Median: 40,052.9Lower quartile: 39,240.4Minimum: 36,050.1

Actions per Minute / DPS Variance Summary

base : 40107 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
40106.9 40106.9 22.9 / 0.057% 4786.5 / 11.9% 4830.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.3 8.2 Astral Power 0.00% 58.5 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
base 40107
Heed My Call 298 (426) 0.7% (1.1%) 8.2 32.54sec 15498 0 Direct 8.2 9128 18254 10847 18.8%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.24 8.24 0.00 0.00 0.0000 0.0000 89360.71 89360.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.69 81.16% 9128.21 8921 9813 9125.17 0 9813 61036 61036 0.00
crit 1.55 18.84% 18253.56 17842 19626 14547.14 0 19626 28325 28325 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 128 0.3% 8.2 32.54sec 4651 0 Direct 8.2 3912 7826 4651 18.9%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.24 8.24 0.00 0.00 0.0000 0.0000 38315.49 38315.49 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.68 81.11% 3911.77 3823 4206 3911.88 0 4206 26140 26140 0.00
crit 1.56 18.89% 7825.67 7646 8411 6214.67 0 8411 12175 12175 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5912 14.8% 78.4 3.74sec 22600 17405 Direct 78.4 19037 38058 22600 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.36 78.36 0.00 0.00 1.2985 0.0000 1770927.75 1770927.75 0.00 17404.70 17404.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.68 81.27% 19037.03 10135 24211 19044.13 18391 20056 1212289 1212289 0.00
crit 14.68 18.73% 38058.12 20270 48422 38072.30 34215 42747 558639 558639 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2866 7.1% 14.1 21.43sec 61036 60861 Direct 14.1 3286 6575 3898 18.6%  
Periodic 224.0 3023 6043 3587 18.7% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.06 14.06 223.98 223.98 1.0029 1.3292 858202.07 858202.07 0.00 2752.31 60861.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.45 81.40% 3286.12 2981 4065 3288.01 3019 3589 37611 37611 0.00
crit 2.62 18.60% 6575.17 5963 8130 6194.50 0 8130 17195 17195 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.2 81.34% 3023.40 4 3785 3024.71 2939 3141 550832 550832 0.00
crit 41.8 18.66% 6043.14 4 7570 6045.48 5685 6600 252564 252564 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 920 2.3% 44.7 6.58sec 6169 0 Direct 44.7 5198 10385 6169 18.7%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.66 44.66 0.00 0.00 0.0000 0.0000 275499.87 275499.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.29 81.27% 5197.59 4769 6503 5199.46 4897 5653 188625 188625 0.00
crit 8.37 18.73% 10385.16 9539 13006 10379.70 0 13006 86875 86875 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3310 (5266) 8.3% (13.1%) 95.7 3.08sec 16482 18322 Direct 96.2 8689 17368 10305 18.6%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.70 96.21 0.00 0.00 0.8996 0.0000 991517.54 991517.54 0.00 18322.30 18322.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.30 81.38% 8689.49 7949 10838 8694.52 8412 9244 680372 680372 0.00
crit 17.92 18.62% 17367.61 15898 21676 17376.80 15898 19737 311146 311146 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1956 4.9% 75.4 3.89sec 7766 0 Direct 75.4 7766 0 7766 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.44 75.44 0.00 0.00 0.0000 0.0000 585849.25 585849.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.44 100.00% 7765.61 5962 16257 7769.43 6700 9185 585849 585849 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starsurge 13740 34.3% 62.1 4.87sec 66234 63414 Direct 61.9 55999 111874 66436 18.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.12 61.93 0.00 0.00 1.0445 0.0000 4114259.33 4114259.33 0.00 63414.35 63414.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.36 81.32% 55999.50 51347 69612 56022.96 53977 58899 2820142 2820142 0.00
crit 11.57 18.68% 111873.83 102695 139223 111905.36 102695 128073 1294117 1294117 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1861 4.6% 12.8 23.57sec 43587 42813 Direct 12.8 2790 5585 3309 18.6%  
Periodic 221.6 1959 3916 2325 18.7% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.79 12.79 221.57 221.57 1.0181 1.3321 557509.35 557509.35 0.00 1808.98 42812.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.41 81.41% 2789.87 2570 3504 2790.62 2570 3120 29050 29050 0.00
crit 2.38 18.59% 5584.66 5140 7009 5142.82 0 7009 13281 13281 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.2 81.31% 1959.20 18 2453 1960.04 1911 2040 352956 352956 0.00
crit 41.4 18.69% 3916.34 5 4906 3917.83 3684 4213 162222 162222 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5929 14.7% 90.9 3.06sec 19429 0 Direct 90.9 16383 32770 19429 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.93 90.93 0.00 0.00 0.0000 0.0000 1766714.22 1766714.22 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.03 81.41% 16383.20 16021 17623 16382.83 16021 17284 1212869 1212869 0.00
crit 16.90 18.59% 32769.59 32042 35246 32769.94 32042 34955 553846 553846 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3187 8.0% 17.8 16.86sec 53758 52854 Direct 17.8 4500 8997 5341 18.7%  
Periodic 223.1 3247 6489 3853 18.7% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.76 17.76 223.15 223.15 1.0171 1.3301 954697.57 954697.57 0.00 3032.08 52853.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.44 81.30% 4499.71 4112 5607 4500.38 4166 4828 64968 64968 0.00
crit 3.32 18.70% 8997.37 8225 11214 8742.04 0 11214 29880 29880 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.4 81.31% 3247.26 2 4065 3248.68 3153 3413 589156 589156 0.00
crit 41.7 18.69% 6488.99 4 8130 6491.34 6086 6961 270694 270694 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
base
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.73sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.55sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.3 54.6 43.7sec 4.9sec 93.19% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.94%
  • arcanic_pulsar_2:10.46%
  • arcanic_pulsar_3:11.13%
  • arcanic_pulsar_4:10.64%
  • arcanic_pulsar_5:13.68%
  • arcanic_pulsar_6:10.79%
  • arcanic_pulsar_7:10.77%
  • arcanic_pulsar_8:13.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.5sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:base
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.7sec 182.7sec 8.11% 7.57% 0.0(0.0) 2.0

Buff details

  • buff initial source:base
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:base
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.3 0.0 37.5sec 37.5sec 26.10% 32.63% 0.0(0.0) 8.1

Buff details

  • buff initial source:base
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.9sec 45.6sec 23.65% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:base
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.22% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:base
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.84%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.7 46.7 8.8sec 3.7sec 82.21% 99.74% 1.9(1.9) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.87%
  • lunar_empowerment_2:31.92%
  • lunar_empowerment_3:14.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.5 64.4sec 33.8sec 48.05% 0.00% 3.5(48.5) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.99%
  • overwhelming_power_15:2.04%
  • overwhelming_power_16:2.11%
  • overwhelming_power_17:2.17%
  • overwhelming_power_18:2.24%
  • overwhelming_power_19:2.30%
  • overwhelming_power_20:2.37%
  • overwhelming_power_21:2.44%
  • overwhelming_power_22:2.52%
  • overwhelming_power_23:2.60%
  • overwhelming_power_24:2.67%
  • overwhelming_power_25:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 25.3 52.5 11.8sec 3.9sec 85.45% 78.56% 0.2(0.2) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.28%
  • solar_empowerment_2:39.78%
  • solar_empowerment_3:17.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 46.8 20.2sec 4.9sec 97.89% 92.85% 16.6(16.6) 11.4

Buff details

  • buff initial source:base
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:13.91%
  • starlord_2:22.52%
  • starlord_3:61.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.1sec 45.6sec 23.64% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:base
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.64%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:base
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:base
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:base
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:base
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:base
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
base
starsurge Astral Power 62.1 2484.7 40.0 40.0 1655.8
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 96.70 773.55 (31.61%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.27%) 40.00 0.00 0.00%
sunfire Astral Power 17.76 53.28 (2.18%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.66 178.63 (7.30%) 4.00 0.00 0.00%
moonfire Astral Power 14.06 42.18 (1.72%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.79 102.33 (4.18%) 8.00 0.00 0.00%
lunar_strike Astral Power 78.36 940.25 (38.42%) 12.00 0.06 0.01%
natures_balance Astral Power 400.36 200.18 (8.18%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.40 76.75 (3.14%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.16 8.28
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.97 0.00 56.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data base Fight Length
Count 11043
Mean 299.90
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data base Damage Per Second
Count 11043
Mean 40106.93
Minimum 36050.07
Maximum 45041.93
Spread ( max - min ) 8991.86
Range [ ( max - min ) / 2 * 100% ] 11.21%
Standard Deviation 1225.4358
5th Percentile 38164.80
95th Percentile 42196.99
( 95th Percentile - 5th Percentile ) 4032.19
Mean Distribution
Standard Deviation 11.6613
95.00% Confidence Intervall ( 40084.07 - 40129.79 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3587
0.1 Scale Factor Error with Delta=300 12820
0.05 Scale Factor Error with Delta=300 51278
0.01 Scale Factor Error with Delta=300 1281932
Priority Target DPS
Sample Data base Priority Target Damage Per Second
Count 11043
Mean 40106.93
Minimum 36050.07
Maximum 45041.93
Spread ( max - min ) 8991.86
Range [ ( max - min ) / 2 * 100% ] 11.21%
Standard Deviation 1225.4358
5th Percentile 38164.80
95th Percentile 42196.99
( 95th Percentile - 5th Percentile ) 4032.19
Mean Distribution
Standard Deviation 11.6613
95.00% Confidence Intervall ( 40084.07 - 40129.79 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3587
0.1 Scale Factor Error with Delta=300 12820
0.05 Scale Factor Error with Delta=300 51278
0.01 Scale Factor Error with Delta=300 1281932
DPS(e)
Sample Data base Damage Per Second (Effective)
Count 11043
Mean 40106.93
Minimum 36050.07
Maximum 45041.93
Spread ( max - min ) 8991.86
Range [ ( max - min ) / 2 * 100% ] 11.21%
Damage
Sample Data base Damage
Count 11043
Mean 12002853.16
Minimum 9289085.60
Maximum 14932551.09
Spread ( max - min ) 5643465.49
Range [ ( max - min ) / 2 * 100% ] 23.51%
DTPS
Sample Data base Damage Taken Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data base Healing Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data base Healing Per Second (Effective)
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data base Heal
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data base Healing Taken Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data base Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data baseTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data base Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 2.96 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 62.12 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 2.70 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 3.13 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 14.84 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
N 10.94 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.79 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 78.73 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 95.96 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.23 sunfire

Sample Sequence

0123456789ACDJNMOHFGJQPJQPJQPQJQPQMQNQPQRJOJQKPJPPPQQQQQJQJQPQPQIJJMNPOPJQPQPJQPPQJJMNQPPJOQPPQQQMQJQJQJQLPPJPOPJMQPQJPQNPJQPJQPMPOQQPJJQGQPJQPLPJMPQQJPPQOQJPQJPNMQJQPQQJPPQQPJOPJMQPJQLPPJPQPQPJHEFJMOQPJNQPJQPJQPQPQPQJJMQPJQLOPJPPPQMQPQJJPPQJPNOQQJMPQQGPQJPJPQQQJQPQJQOKNPPQQIJJPPJQPMPJNQPQQOQQJJPQPJMQPQQNQQQQIJQJOQPJMPJPPPJQNPQJPMQQOJPQQJPQPJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask base 58.0/100: 58% astral_power
Pre precombat 1 food base 58.0/100: 58% astral_power
Pre precombat 2 augmentation base 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.238 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.162 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), battle_potion_of_intellect
0:03.012 default O stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(23), battle_potion_of_intellect
0:03.863 default H celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(23), battle_potion_of_intellect
0:04.618 default F berserking Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(22), battle_potion_of_intellect
0:04.618 default G use_items Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(22), battle_potion_of_intellect
0:04.618 default J starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse
0:05.374 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse
0:06.127 default P lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse
0:06.938 default J starsurge Fluffy_Pillow 72.5/100: 73% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse
0:07.692 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse
0:08.446 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse
0:09.227 default J starsurge Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(2)
0:09.981 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.736 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.491 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.246 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.000 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:13.754 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.508 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.262 default M sunfire Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.016 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.771 default N moonfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.527 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.284 default P lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.065 default Q solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(17), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.822 default R sunfire Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(17), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.579 default J starsurge Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overwhelming_power(16), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.333 default O stellar_flare Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(15), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.087 default J starsurge Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(14), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.841 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(14), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.594 default K sunfire Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(13), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.349 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(12), conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.256 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(11), conch_of_dark_whispers
0:26.120 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), conch_of_dark_whispers
0:27.195 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9), conch_of_dark_whispers
0:28.273 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8), conch_of_dark_whispers
0:29.355 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(7), conch_of_dark_whispers
0:30.110 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(6), conch_of_dark_whispers
0:30.865 default Q solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(6), conch_of_dark_whispers
0:31.720 default Q solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(5), conch_of_dark_whispers
0:32.578 default Q solar_wrath Fluffy_Pillow 85.5/100: 86% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(4), conch_of_dark_whispers
0:33.438 default J starsurge Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(3)
0:34.305 default Q solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(2)
0:35.060 default J starsurge Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power
0:35.817 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power
0:36.570 default P lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements
0:37.540 default Q solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
0:38.294 default P lunar_strike Fluffy_Pillow 73.5/100: 74% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements
0:39.263 default Q solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3)
0:40.025 default I cancel_buff Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3)
0:40.025 default J starsurge Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment
0:40.854 default J starsurge Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord
0:41.781 default M sunfire Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2)
0:42.948 default N moonfire Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2)
0:44.117 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2)
0:45.605 default O stellar_flare Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
0:46.774 default P lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
0:48.264 default J starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2)
0:49.432 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:50.401 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:51.849 default Q solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3)
0:52.813 default P lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:54.261 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
0:55.396 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:56.363 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:57.813 default P lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
0:59.261 default Q solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3)
1:00.229 default J starsurge Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(5), solar_empowerment
1:01.467 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord
1:02.670 default M sunfire Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2)
1:03.840 default N moonfire Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2)
1:05.008 default Q solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2)
1:06.001 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:07.490 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2)
1:08.978 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2)
1:10.146 default O stellar_flare Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3)
1:11.282 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3)
1:12.250 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:13.697 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
1:15.145 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3)
1:16.111 default Q solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3)
1:17.077 default Q solar_wrath Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(8), starlord(3)
1:18.213 default M sunfire Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(8), starlord(3)
1:19.350 default Q solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar(8), starlord(3)
1:20.487 default J starsurge Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar(8)
1:21.726 default Q solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord
1:22.615 default J starsurge Fluffy_Pillow 78.0/100: 78% astral_power celestial_alignment, lunar_empowerment, starlord
1:23.662 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements
1:24.527 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements
1:25.543 default Q solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements
1:26.383 default L moonfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements
1:27.371 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), torrent_of_elements
1:28.819 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), torrent_of_elements
1:30.267 default J starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), torrent_of_elements
1:31.401 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
1:32.850 default O stellar_flare Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
1:33.988 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
1:35.437 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements
1:36.573 default M sunfire Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
1:37.711 default Q solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
1:38.678 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
1:40.124 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements
1:41.091 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, torrent_of_elements
1:42.329 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements
1:43.863 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements
1:44.885 default N moonfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord
1:46.086 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord
1:47.618 default J starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord
1:48.821 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2)
1:49.812 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2)
1:51.302 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2)
1:52.470 default Q solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3)
1:53.437 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:54.884 default M sunfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
1:56.020 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
1:57.467 default O stellar_flare Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
1:58.604 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
1:59.569 default Q solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
2:00.536 default P lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), overwhelming_power(25)
2:01.861 default J starsurge Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(7), overwhelming_power(24)
2:02.997 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(23)
2:04.105 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21)
2:04.906 default G use_items Fluffy_Pillow 22.0/100: 22% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(21)
2:04.906 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(21), ignition_mages_fuse
2:05.677 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(20), ignition_mages_fuse
2:06.834 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(19), ignition_mages_fuse
2:07.744 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(18), ignition_mages_fuse
2:08.500 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(17), ignition_mages_fuse
2:09.638 default L moonfire Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(16), ignition_mages_fuse(2)
2:10.501 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(15), ignition_mages_fuse(2)
2:11.766 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, starlord(3), overwhelming_power(14), ignition_mages_fuse(2)
2:12.763 default M sunfire Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(13), ignition_mages_fuse(2)
2:13.763 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(12), ignition_mages_fuse(3)
2:14.991 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(11), ignition_mages_fuse(3)
2:15.816 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(10), ignition_mages_fuse(3)
2:16.644 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(9), ignition_mages_fuse(3)
2:17.618 default P lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(8), ignition_mages_fuse(4)
2:18.817 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(7), ignition_mages_fuse(4)
2:20.020 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(5), ignition_mages_fuse(4)
2:20.829 default O stellar_flare Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, overwhelming_power(5), ignition_mages_fuse(4)
2:21.778 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, overwhelming_power(4), ignition_mages_fuse(5)
2:22.697 default J starsurge Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(3), torrent_of_elements, overwhelming_power(3), ignition_mages_fuse(5)
2:23.701 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(2), ignition_mages_fuse(5)
2:24.949 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power
2:25.967 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(4), solar_empowerment, starlord, torrent_of_elements
2:27.170 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
2:28.659 default N moonfire Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2), torrent_of_elements
2:29.827 default M sunfire Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2)
2:30.997 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2), overwhelming_power(24)
2:31.910 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(23)
2:32.987 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(22)
2:33.881 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21)
2:35.222 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), overwhelming_power(19)
2:36.125 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(18)
2:37.030 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(17)
2:38.100 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16)
2:39.467 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15)
2:40.839 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(14)
2:41.756 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(13)
2:42.678 default P lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(12)
2:44.063 default J starsurge Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(7), torrent_of_elements, overwhelming_power(10)
2:45.257 default O stellar_flare Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(9)
2:46.423 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(8)
2:47.911 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(8), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(7)
2:49.082 default M sunfire Fluffy_Pillow 23.5/100: 24% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(5)
2:50.080 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(4)
2:50.932 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(4)
2:52.208 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(2)
2:53.217 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power
2:54.054 default L moonfire Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
2:55.043 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
2:56.490 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
2:57.937 default J starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar, solar_empowerment, starlord(3)
2:59.075 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3)
3:00.520 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:01.486 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
3:02.933 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), conch_of_dark_whispers
3:03.899 default P lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), conch_of_dark_whispers
3:05.347 default J starsurge Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(2), solar_empowerment, conch_of_dark_whispers
3:06.585 default H celestial_alignment Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers
3:07.632 default E potion Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers
3:07.632 default F berserking Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:07.632 default J starsurge Fluffy_Pillow 82.0/100: 82% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:08.585 default M sunfire Fluffy_Pillow 46.5/100: 47% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:09.510 default O stellar_flare Fluffy_Pillow 54.0/100: 54% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:10.435 default Q solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:11.222 default P lunar_strike Fluffy_Pillow 71.0/100: 71% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:12.399 default J starsurge Fluffy_Pillow 84.0/100: 84% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:13.323 default N moonfire Fluffy_Pillow 44.5/100: 45% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect
3:14.148 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect
3:14.902 default P lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), battle_potion_of_intellect
3:15.956 default J starsurge Fluffy_Pillow 73.5/100: 74% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), battle_potion_of_intellect
3:16.788 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(21), battle_potion_of_intellect
3:17.544 default P lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), battle_potion_of_intellect
3:18.609 default J starsurge Fluffy_Pillow 55.0/100: 55% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), battle_potion_of_intellect
3:19.448 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(18), battle_potion_of_intellect
3:20.202 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), battle_potion_of_intellect
3:21.384 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16), battle_potion_of_intellect
3:22.177 default P lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(25), battle_potion_of_intellect
3:23.328 default Q solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25), battle_potion_of_intellect
3:24.097 default P lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24), battle_potion_of_intellect
3:25.250 default Q solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(7), celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect
3:26.025 default J starsurge Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, overwhelming_power(22), battle_potion_of_intellect
3:27.020 default J starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(21), battle_potion_of_intellect
3:28.135 default M sunfire Fluffy_Pillow 21.5/100: 22% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(20), battle_potion_of_intellect
3:29.081 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(19), battle_potion_of_intellect
3:29.887 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(19), battle_potion_of_intellect
3:31.097 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(17), battle_potion_of_intellect
3:32.052 default Q solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(16), battle_potion_of_intellect
3:32.845 default L moonfire Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(16)
3:33.779 default O stellar_flare Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(15)
3:34.856 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(14)
3:36.231 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(12)
3:37.320 default P lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(11)
3:38.711 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(10)
3:40.105 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8)
3:41.511 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(7)
3:42.451 default M sunfire Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(6)
3:43.563 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(5)
3:44.511 default P lunar_strike Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(4)
3:45.938 default Q solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(3)
3:47.062 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(2), overwhelming_power
3:48.295 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord
3:49.497 default P lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2)
3:50.988 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2)
3:52.476 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2)
3:53.467 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2)
3:54.636 default P lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
3:56.084 default N moonfire Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3)
3:57.221 default O stellar_flare Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3)
3:58.358 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(24)
3:59.243 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(23)
4:00.133 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(22)
4:01.184 default M sunfire Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(21)
4:02.238 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(20)
4:03.586 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(19)
4:04.489 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(18)
4:05.553 default G use_items Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), overwhelming_power(17)
4:05.553 default P lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), overwhelming_power(17), ignition_mages_fuse
4:06.859 default Q solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(16), ignition_mages_fuse
4:07.887 default J starsurge Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(6), overwhelming_power(15), ignition_mages_fuse
4:09.013 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(13), ignition_mages_fuse
4:10.415 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(7), solar_empowerment, starlord, overwhelming_power(12), ignition_mages_fuse(2)
4:11.477 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(11), ignition_mages_fuse(2)
4:12.795 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(10), ignition_mages_fuse(2)
4:13.677 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), overwhelming_power(9), ignition_mages_fuse(3)
4:14.530 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), starlord(2), overwhelming_power(8), ignition_mages_fuse(3)
4:15.535 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(8), starlord(2), overwhelming_power(7), ignition_mages_fuse(3)
4:16.544 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(6), ignition_mages_fuse(3)
4:17.297 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(5), ignition_mages_fuse(3)
4:18.391 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power celestial_alignment, starlord(3), overwhelming_power(4), ignition_mages_fuse(4)
4:19.222 default J starsurge Fluffy_Pillow 54.5/100: 55% astral_power celestial_alignment, starlord(3), overwhelming_power(3), ignition_mages_fuse(4)
4:20.056 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(2), ignition_mages_fuse(4)
4:20.812 default O stellar_flare Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(2), ignition_mages_fuse(4)
4:21.646 default K sunfire Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power, ignition_mages_fuse(5)
4:22.454 default N moonfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, lunar_empowerment(2), starlord(3), overwhelming_power(24), ignition_mages_fuse(5)
4:23.323 default P lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, lunar_empowerment(2), starlord(3), overwhelming_power(23), ignition_mages_fuse(5)
4:24.429 default P lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(22), ignition_mages_fuse(5)
4:25.539 default Q solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar, starlord(3), overwhelming_power(21), ignition_mages_fuse(5)
4:26.415 default Q solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar, starlord(3), overwhelming_power(20)
4:27.473 default I cancel_buff Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(19)
4:27.473 default J starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar, lunar_empowerment, overwhelming_power(19)
4:28.630 default J starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(18)
4:29.756 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(17)
4:31.155 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(15)
4:32.564 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(14)
4:33.674 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(13)
4:34.594 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12)
4:35.978 default M sunfire Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(11)
4:37.069 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9)
4:38.470 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8)
4:39.573 default N moonfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(7)
4:40.681 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(6)
4:41.627 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(5)
4:43.048 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(3)
4:44.003 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(2)
4:44.963 default O stellar_flare Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, overwhelming_power(2)
4:46.094 default Q solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements
4:47.230 default Q solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(5), starlord(3)
4:48.367 default J starsurge Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(5)
4:49.606 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord
4:50.809 default P lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2)
4:52.299 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2)
4:53.294 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2)
4:54.782 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2)
4:55.950 default M sunfire Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3)
4:57.087 default Q solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
4:58.053 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:59.500 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), conch_of_dark_whispers
5:00.467 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), conch_of_dark_whispers
5:01.434 default N moonfire Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
5:02.570 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
5:03.706 default Q solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
5:04.843 default Q solar_wrath Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
5:05.980 default Q solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(25), conch_of_dark_whispers
5:07.020 default I cancel_buff Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers
5:07.020 default J starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(8), lunar_empowerment, overwhelming_power(23), conch_of_dark_whispers
5:08.161 default Q solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(22), conch_of_dark_whispers
5:08.984 default J starsurge Fluffy_Pillow 73.5/100: 74% astral_power celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(22), conch_of_dark_whispers
5:09.951 default O stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(21), conch_of_dark_whispers
5:10.893 default Q solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(20), conch_of_dark_whispers
5:11.697 default P lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(19)
5:12.906 default J starsurge Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(18)
5:13.858 default M sunfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(17)
5:14.926 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(16)
5:16.290 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(14)
5:17.371 default P lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(13)
5:18.751 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(12)
5:20.136 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10)
5:21.530 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9)
5:22.630 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(8)
5:23.570 default N moonfire Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(7)
5:24.677 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6)
5:26.095 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(4)
5:27.047 default J starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(4), solar_empowerment, torrent_of_elements, overwhelming_power(3)
5:28.272 default P lunar_strike Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(2)
5:29.792 default M sunfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power
5:30.989 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, torrent_of_elements
5:32.011 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(5), solar_empowerment, starlord, torrent_of_elements
5:33.033 default O stellar_flare Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(5), starlord, torrent_of_elements
5:34.235 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(5), starlord
5:35.438 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2)
5:36.927 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2)
5:37.922 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(6), starlord(2), conch_of_dark_whispers
5:39.091 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(6), starlord(2), conch_of_dark_whispers
5:40.259 default P lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
5:41.708 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), conch_of_dark_whispers
5:42.674 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), conch_of_dark_whispers
5:44.122 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), conch_of_dark_whispers

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="base"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

blood of the enemy : 42762 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
42762.4 42762.4 26.9 / 0.063% 5592.5 / 13.1% 5163.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.3 8.1 Astral Power 0.00% 59.0 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
blood of the enemy 42762
Blood of the Enemy 442 1.0% 3.7 91.14sec 35898 37546 Direct 3.7 27661 69194 35896 19.8%  

Stats details: blood_of_the_enemy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.69 3.69 0.00 0.00 0.9561 0.0000 132461.62 132461.62 0.00 37545.81 37545.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.96 80.17% 27661.30 27139 29853 27553.15 0 29853 81827 81827 0.00
crit 0.73 19.83% 69194.32 67847 74632 38309.98 0 74632 50634 50634 0.00
 
 

Action details: blood_of_the_enemy

Static Values
  • id:297108
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown.ca_inc.remains>30
Spelldata
  • id:297108
  • name:Blood of the Enemy
  • school:shadow
  • tooltip:You have a $w2% increased chance to be Critically Hit by the caster.
  • description:The Heart of Azeroth erupts violently, dealing {$s1=5936} Shadow damage to enemies within $A1 yds. You gain $m2% critical strike chance against the targets for {$d=10 seconds}$?a297122[, and increases your critical hit damage by $297126m% for {$297126d=5 seconds}][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24659.81
  • base_dd_max:24659.81
  • base_dd_mult:1.00
 
Heed My Call 316 (452) 0.7% (1.1%) 8.3 32.83sec 16273 0 Direct 8.3 9129 18738 11394 23.6%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.32 8.32 0.00 0.00 0.0000 0.0000 94816.66 94816.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.36 76.43% 9129.43 8921 9813 9127.18 0 9813 58068 58068 0.00
crit 1.96 23.57% 18738.11 17842 24532 16249.38 0 24532 36748 36748 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 135 0.3% 8.3 32.83sec 4879 0 Direct 8.3 3912 8037 4879 23.5%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.32 8.32 0.00 0.00 0.0000 0.0000 40604.60 40604.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.37 76.55% 3911.91 3823 4206 3911.32 0 4206 24920 24920 0.00
crit 1.95 23.45% 8037.41 7646 10514 6989.68 0 10514 15685 15685 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6107 14.3% 78.1 3.75sec 23437 18221 Direct 78.1 18961 38950 23437 22.4%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.06 78.06 0.00 0.00 1.2863 0.0000 1829439.23 1829439.23 0.00 18220.78 18220.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.58 77.61% 18961.33 10135 24211 18968.11 18278 19918 1148649 1148649 0.00
crit 17.48 22.39% 38950.15 20270 60528 38983.40 35007 45465 680791 680791 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3046 7.1% 14.1 21.43sec 64888 65040 Direct 14.1 3273 6798 4073 22.7%  
Periodic 226.3 3009 6321 3778 23.2% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.05 14.05 226.27 226.27 0.9977 1.3158 911995.74 911995.74 0.00 2925.55 65040.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.87 77.31% 3273.48 2981 4065 3274.61 2981 3590 35567 35567 0.00
crit 3.19 22.69% 6797.71 5963 10163 6618.55 0 10163 21682 21682 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 173.8 76.79% 3008.92 2 3785 3010.12 2922 3139 522809 522809 0.00
crit 52.5 23.21% 6320.94 8 9462 6326.71 5890 7004 331938 331938 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 978 2.3% 45.1 6.49sec 6492 0 Direct 45.1 5174 10852 6492 23.2%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.10 45.10 0.00 0.00 0.0000 0.0000 292753.95 292753.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.63 76.79% 5173.72 4769 6503 5175.97 4855 5732 179172 179172 0.00
crit 10.47 23.21% 10852.44 9539 16257 10858.11 0 16257 113582 113582 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3431 (5476) 8.0% (12.8%) 95.1 3.09sec 17249 19330 Direct 95.6 8641 17828 10748 22.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.07 95.58 0.00 0.00 0.8924 0.0000 1027319.73 1027319.73 0.00 19330.32 19330.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.66 77.06% 8640.92 7949 10838 8645.07 8344 9056 636483 636483 0.00
crit 21.92 22.94% 17828.26 15898 27096 17845.35 16452 20004 390837 390837 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2046 4.8% 75.2 3.89sec 8149 0 Direct 75.2 8149 0 8149 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.16 75.16 0.00 0.00 0.0000 0.0000 612510.37 612510.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.16 100.00% 8148.90 5962 20322 8155.66 6989 9850 612510 612510 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starsurge 14504 33.9% 61.9 4.88sec 70078 67699 Direct 61.7 55684 117688 70301 23.6%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.95 61.75 0.00 0.00 1.0351 0.0000 4341023.33 4341023.33 0.00 67699.44 67699.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.19 76.43% 55684.09 51347 69612 55703.15 53641 59229 2627872 2627872 0.00
crit 14.56 23.57% 117688.02 102695 174029 117871.30 102695 139503 1713151 1713151 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1982 4.6% 12.8 23.57sec 46364 45807 Direct 12.8 2776 5891 3476 22.5%  
Periodic 224.0 1950 4099 2450 23.3% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.80 12.80 223.99 223.99 1.0122 1.3178 593333.83 593333.83 0.00 1925.65 45806.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.92 77.53% 2776.29 2570 3504 2775.95 2570 3110 27545 27545 0.00
crit 2.88 22.47% 5891.47 5140 8761 5693.59 0 8761 16942 16942 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 171.9 76.73% 1950.34 4 2453 1951.13 1897 2034 335208 335208 0.00
crit 52.1 23.27% 4098.97 51 6133 4102.64 3808 4501 213639 213639 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6395 14.9% 89.9 3.09sec 21185 0 Direct 89.9 16390 34154 21185 27.0%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.90 89.90 0.00 0.00 0.0000 0.0000 1904553.70 1904553.70 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.64 73.01% 16390.32 16021 17623 16390.23 16021 17303 1075802 1075802 0.00
crit 24.26 26.99% 34154.03 32042 44057 34167.90 32042 38120 828752 828752 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3380 7.9% 17.9 16.76sec 56694 56161 Direct 17.9 4487 9276 5556 22.3%  
Periodic 225.4 3232 6777 4050 23.1% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.85 17.85 225.41 225.41 1.0095 1.3168 1012073.81 1012073.81 0.00 3214.46 56160.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.87 77.67% 4486.62 4112 5607 4486.68 4148 4849 62209 62209 0.00
crit 3.99 22.33% 9275.97 8225 14018 9179.55 0 14018 36974 36974 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 173.4 76.93% 3232.30 10 4065 3233.58 3145 3368 560545 560545 0.00
crit 52.0 23.07% 6776.52 9 10163 6782.66 6329 7454 352346 352346 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
blood of the enemy
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.65sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.56sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8983 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.3 54.5 43.8sec 4.9sec 93.25% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.84%
  • arcanic_pulsar_2:10.25%
  • arcanic_pulsar_3:11.57%
  • arcanic_pulsar_4:10.87%
  • arcanic_pulsar_5:13.53%
  • arcanic_pulsar_6:10.52%
  • arcanic_pulsar_7:10.68%
  • arcanic_pulsar_8:14.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.6sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.7sec 182.7sec 8.11% 7.68% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blood-Soaked 5.5 0.0 54.9sec 54.9sec 14.48% 0.00% 0.0(0.0) 5.4

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodsoaked
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:631.87

Stack Uptimes

  • bloodsoaked_1:14.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297168
  • name:Blood-Soaked
  • tooltip:Haste increased by $w1. While active Blood of the Enemy stacks are not granted.
  • description:{$@spelldesc297147=Your critical strikes with spells and abilities grant a stack of Blood-Soaked$?a297177[, increasing Critical Strike by {$297147s3=0}][]. Upon reaching {$297162u=40} stacks, you gain {$s2=0} Haste for {$297168d=8 seconds}.$?a297178[ Blood-Soaked has a {$297178s1=25}% chance of only consuming {$297178s2=30} stacks.][]}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Blood-Soaked (_counter) 5.0 218.1 63.1sec 1.3sec 86.62% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodsoaked_counter
  • max_stacks:40
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:9.69

Stack Uptimes

  • bloodsoaked_counter_1:2.50%
  • bloodsoaked_counter_2:2.30%
  • bloodsoaked_counter_3:2.13%
  • bloodsoaked_counter_4:2.03%
  • bloodsoaked_counter_5:1.98%
  • bloodsoaked_counter_6:1.95%
  • bloodsoaked_counter_7:1.92%
  • bloodsoaked_counter_8:1.91%
  • bloodsoaked_counter_9:1.88%
  • bloodsoaked_counter_10:6.06%
  • bloodsoaked_counter_11:2.44%
  • bloodsoaked_counter_12:2.45%
  • bloodsoaked_counter_13:2.41%
  • bloodsoaked_counter_14:2.37%
  • bloodsoaked_counter_15:2.33%
  • bloodsoaked_counter_16:2.32%
  • bloodsoaked_counter_17:2.30%
  • bloodsoaked_counter_18:2.26%
  • bloodsoaked_counter_19:2.23%
  • bloodsoaked_counter_20:2.22%
  • bloodsoaked_counter_21:2.20%
  • bloodsoaked_counter_22:2.17%
  • bloodsoaked_counter_23:2.16%
  • bloodsoaked_counter_24:2.15%
  • bloodsoaked_counter_25:2.11%
  • bloodsoaked_counter_26:2.10%
  • bloodsoaked_counter_27:2.08%
  • bloodsoaked_counter_28:2.07%
  • bloodsoaked_counter_29:2.03%
  • bloodsoaked_counter_30:2.04%
  • bloodsoaked_counter_31:2.00%
  • bloodsoaked_counter_32:2.00%
  • bloodsoaked_counter_33:1.97%
  • bloodsoaked_counter_34:1.96%
  • bloodsoaked_counter_35:1.95%
  • bloodsoaked_counter_36:1.92%
  • bloodsoaked_counter_37:1.93%
  • bloodsoaked_counter_38:1.90%
  • bloodsoaked_counter_39:1.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297162
  • name:Blood-Soaked
  • tooltip:$?a297177[Critical strike increased by $w2. ][]$@spellaura297147
  • description:{$@spelldesc297147=Your critical strikes with spells and abilities grant a stack of Blood-Soaked$?a297177[, increasing Critical Strike by {$297147s3=0}][]. Upon reaching {$297162u=40} stacks, you gain {$s2=0} Haste for {$297168d=8 seconds}.$?a297178[ Blood-Soaked has a {$297178s1=25}% chance of only consuming {$297178s2=30} stacks.][]}
  • max_stacks:40
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Celestial Alignment 8.3 0.0 37.4sec 37.4sec 26.05% 32.50% 0.0(0.0) 8.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.8sec 45.1sec 23.74% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.22% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.84%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.4 46.7 8.8sec 3.7sec 82.10% 99.80% 1.9(1.9) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.78%
  • lunar_empowerment_2:32.02%
  • lunar_empowerment_3:14.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.6 64.2sec 33.5sec 48.40% 0.00% 3.6(49.8) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.59%
  • overwhelming_power_7:1.63%
  • overwhelming_power_8:1.68%
  • overwhelming_power_9:1.73%
  • overwhelming_power_10:1.78%
  • overwhelming_power_11:1.83%
  • overwhelming_power_12:1.89%
  • overwhelming_power_13:1.94%
  • overwhelming_power_14:2.00%
  • overwhelming_power_15:2.06%
  • overwhelming_power_16:2.12%
  • overwhelming_power_17:2.19%
  • overwhelming_power_18:2.25%
  • overwhelming_power_19:2.32%
  • overwhelming_power_20:2.39%
  • overwhelming_power_21:2.46%
  • overwhelming_power_22:2.54%
  • overwhelming_power_23:2.62%
  • overwhelming_power_24:2.70%
  • overwhelming_power_25:1.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Seething Rage 3.7 0.0 91.1sec 91.1sec 6.12% 0.00% 0.0(0.0) 3.6

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_seething_rage
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • seething_rage_1:6.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297126
  • name:Seething Rage
  • tooltip:Critical strike damage increased by $w1%.
  • description:{$@spelldesc297122=Increases your critical hit damage by $297126m% for {$297126d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Solar Empowerment 24.8 52.7 12.0sec 3.9sec 85.89% 78.77% 0.3(0.3) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.21%
  • solar_empowerment_2:39.98%
  • solar_empowerment_3:17.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 46.6 20.2sec 4.9sec 97.82% 93.07% 16.4(16.4) 11.4

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.36%
  • starlord_2:22.48%
  • starlord_3:60.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.9sec 45.5sec 23.69% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.69%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
blood of the enemy
starsurge Astral Power 61.9 2477.8 40.0 40.0 1751.9
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 96.07 768.46 (31.49%) 8.00 0.06 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.28%) 40.00 0.00 0.00%
sunfire Astral Power 17.85 53.55 (2.19%) 3.00 0.00 0.00%
shooting_stars Astral Power 45.10 180.38 (7.39%) 4.00 0.01 0.01%
moonfire Astral Power 14.05 42.16 (1.73%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.80 102.38 (4.20%) 8.00 0.00 0.00%
lunar_strike Astral Power 78.06 936.62 (38.38%) 12.00 0.07 0.01%
natures_balance Astral Power 400.36 200.18 (8.20%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.38 76.52 (3.14%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.14 8.26
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.09 0.00 56.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data blood of the enemy Fight Length
Count 11043
Mean 299.90
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data blood of the enemy Damage Per Second
Count 11043
Mean 42762.42
Minimum 37918.72
Maximum 49279.19
Spread ( max - min ) 11360.47
Range [ ( max - min ) / 2 * 100% ] 13.28%
Standard Deviation 1441.2671
5th Percentile 40506.95
95th Percentile 45232.09
( 95th Percentile - 5th Percentile ) 4725.14
Mean Distribution
Standard Deviation 13.7152
95.00% Confidence Intervall ( 42735.54 - 42789.30 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4364
0.1 Scale Factor Error with Delta=300 17733
0.05 Scale Factor Error with Delta=300 70931
0.01 Scale Factor Error with Delta=300 1773261
Priority Target DPS
Sample Data blood of the enemy Priority Target Damage Per Second
Count 11043
Mean 42762.42
Minimum 37918.72
Maximum 49279.19
Spread ( max - min ) 11360.47
Range [ ( max - min ) / 2 * 100% ] 13.28%
Standard Deviation 1441.2671
5th Percentile 40506.95
95th Percentile 45232.09
( 95th Percentile - 5th Percentile ) 4725.14
Mean Distribution
Standard Deviation 13.7152
95.00% Confidence Intervall ( 42735.54 - 42789.30 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4364
0.1 Scale Factor Error with Delta=300 17733
0.05 Scale Factor Error with Delta=300 70931
0.01 Scale Factor Error with Delta=300 1773261
DPS(e)
Sample Data blood of the enemy Damage Per Second (Effective)
Count 11043
Mean 42762.42
Minimum 37918.72
Maximum 49279.19
Spread ( max - min ) 11360.47
Range [ ( max - min ) / 2 * 100% ] 13.28%
Damage
Sample Data blood of the enemy Damage
Count 11043
Mean 12792886.56
Minimum 9879103.56
Maximum 15876832.99
Spread ( max - min ) 5997729.43
Range [ ( max - min ) / 2 * 100% ] 23.44%
DTPS
Sample Data blood of the enemy Damage Taken Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data blood of the enemy Healing Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data blood of the enemy Healing Per Second (Effective)
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data blood of the enemy Heal
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data blood of the enemy Healing Taken Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data blood of the enemy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data blood of the enemyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data blood of the enemy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
H 3.69 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.99 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 61.95 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.80 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 3.08 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.76 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 10.98 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.80 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 78.42 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 95.32 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.29 sunfire

Sample Sequence

0123456789ACDKONPIFGHKRKRQRQKRQKRNRQORQRKPKRQKQQRQRRRRRKNKRQRQRMRKQKQPQKRQNRKRQRQRKOQKRQQKNPRQQRRRJKRKRQKRMQNKQQQPHRQRKKQQNORKRQRKRQQPRKRQNGRKRQKRQKORQQQRQRKNPRKRQQKORQKRQQRNRKKRPQRKRQKRQMQNRRQRKKQQIEFHRKPRKORQNRKRQRQRKRKRLQKRQKPRMQKQQQKRNQRKQRQKQROPRQRNKQGKQRKRQRQRRRQRKOPRSJKRQKQKQQQKRQRKHNOQRRKPQRKQQRKQNRQRRORQKRKPKRLQQKQQRKQRRORKQRKNPQRQKQRKQRQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask blood of the enemy 58.0/100: 58% astral_power
Pre precombat 1 food blood of the enemy 58.0/100: 58% astral_power
Pre precombat 2 augmentation blood of the enemy 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.237 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.161 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.087 default P stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(2), battle_potion_of_intellect
0:04.012 default I celestial_alignment Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(2), battle_potion_of_intellect
0:04.817 default F berserking Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(3), battle_potion_of_intellect
0:04.817 default G use_items Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(3), battle_potion_of_intellect
0:04.817 default H blood_of_the_enemy Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(3), battle_potion_of_intellect, ignition_mages_fuse
0:05.571 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(4), battle_potion_of_intellect, ignition_mages_fuse
0:06.327 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(7), battle_potion_of_intellect, ignition_mages_fuse
0:07.080 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), bloodsoaked_counter(10), battle_potion_of_intellect, ignition_mages_fuse
0:07.835 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(11), battle_potion_of_intellect, ignition_mages_fuse
0:08.590 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked_counter(13), battle_potion_of_intellect, ignition_mages_fuse
0:09.435 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(15), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.189 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(17), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.997 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(19), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.751 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(20), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.506 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(21), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.315 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.070 default R solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.825 default N sunfire Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(25), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.579 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(26), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.334 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(27), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.114 default O moonfire Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(27), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.868 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(30), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.623 default Q lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(30), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.445 default R solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(31), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.199 default K starsurge Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, torrent_of_elements, bloodsoaked_counter(34), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.953 default P stellar_flare Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, bloodsoaked_counter(36), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.708 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, bloodsoaked_counter(36), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.463 default R solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(39), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.217 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(5)
0:23.984 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.738 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.598 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked, conch_of_dark_whispers
0:26.634 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked, conch_of_dark_whispers
0:27.388 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked, conch_of_dark_whispers
0:28.425 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), bloodsoaked, conch_of_dark_whispers
0:29.178 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), bloodsoaked, conch_of_dark_whispers
0:29.934 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, arcanic_pulsar(8), starlord(3), bloodsoaked, conch_of_dark_whispers
0:30.747 default R solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, arcanic_pulsar(8), starlord(3), bloodsoaked, conch_of_dark_whispers
0:31.560 default R solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar(8), starlord(3), bloodsoaked_counter(2), conch_of_dark_whispers
0:32.435 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), bloodsoaked_counter(4), conch_of_dark_whispers
0:33.309 default N sunfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(6), conch_of_dark_whispers
0:34.070 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(8), conch_of_dark_whispers
0:34.832 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(8), conch_of_dark_whispers
0:35.586 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked_counter(9), conch_of_dark_whispers
0:36.558 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(10), conch_of_dark_whispers
0:37.312 default Q lunar_strike Fluffy_Pillow 61.5/100: 62% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), bloodsoaked_counter(12), conch_of_dark_whispers
0:38.282 default R solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), bloodsoaked_counter(13), conch_of_dark_whispers
0:39.046 default M moonfire Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), bloodsoaked_counter(14), conch_of_dark_whispers
0:39.808 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), starlord(3), bloodsoaked_counter(17), conch_of_dark_whispers
0:40.682 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), bloodsoaked_counter(18), conch_of_dark_whispers
0:41.634 default Q lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord, bloodsoaked_counter(18), conch_of_dark_whispers
0:43.167 default K starsurge Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter(19)
0:44.369 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), bloodsoaked_counter(21)
0:45.858 default P stellar_flare Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(22)
0:47.027 default Q lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(24)
0:48.514 default K starsurge Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(24)
0:49.680 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(25)
0:50.647 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(25)
0:52.094 default N sunfire Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(25)
0:53.231 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(25)
0:54.197 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(25)
0:55.332 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(26)
0:56.298 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(27)
0:57.745 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(27)
0:58.711 default Q lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(28)
1:00.160 default R solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(24), bloodsoaked_counter(28)
1:01.047 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, overwhelming_power(23), bloodsoaked_counter(28)
1:02.186 default O moonfire Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(22), bloodsoaked_counter(29)
1:03.298 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(21), bloodsoaked_counter(29)
1:04.720 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(20), bloodsoaked_counter(30)
1:05.838 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(19), bloodsoaked_counter(30)
1:06.765 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(18), bloodsoaked_counter(31)
1:08.161 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16), bloodsoaked_counter(32)
1:09.564 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(15), bloodsoaked_counter(34)
1:10.672 default N sunfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(14), bloodsoaked_counter(36)
1:11.752 default P stellar_flare Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(25), bloodsoaked_counter(36)
1:12.792 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(24), bloodsoaked_counter(37)
1:13.679 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), bloodsoaked_counter(37)
1:15.011 default Q lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), bloodsoaked_counter(37)
1:16.351 default R solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(20), bloodsoaked_counter(38)
1:17.252 default R solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), bloodsoaked_counter(38)
1:18.152 default R solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18), bloodsoaked_counter(39)
1:19.058 default J cancel_buff Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17), bloodsoaked_counter(10), bloodsoaked
1:19.058 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(8), lunar_empowerment, torrent_of_elements, overwhelming_power(17), bloodsoaked_counter(10), bloodsoaked
1:20.146 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(16), bloodsoaked_counter(10), bloodsoaked
1:20.929 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(16), bloodsoaked_counter(10), bloodsoaked
1:21.848 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(15), bloodsoaked_counter(10), bloodsoaked
1:22.612 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(14), bloodsoaked_counter(10), bloodsoaked
1:23.760 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(13), bloodsoaked_counter(10), bloodsoaked
1:24.662 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(12), bloodsoaked_counter(10), bloodsoaked
1:25.416 default M moonfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(11), bloodsoaked_counter(10), bloodsoaked
1:26.302 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(10), bloodsoaked_counter(10), bloodsoaked
1:27.602 default N sunfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9), bloodsoaked_counter(10)
1:28.701 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8), bloodsoaked_counter(10)
1:29.805 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(7), bloodsoaked_counter(11), conch_of_dark_whispers
1:31.214 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(5), bloodsoaked_counter(13), conch_of_dark_whispers
1:32.634 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(4), bloodsoaked_counter(13), conch_of_dark_whispers
1:34.062 default P stellar_flare Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(2), bloodsoaked_counter(14), conch_of_dark_whispers
1:35.189 default H blood_of_the_enemy Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power, bloodsoaked_counter(15), conch_of_dark_whispers
1:36.322 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power seething_rage, arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(15), conch_of_dark_whispers
1:37.288 default Q lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power seething_rage, arcanic_pulsar(3), lunar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(16), conch_of_dark_whispers
1:38.736 default R solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power seething_rage, arcanic_pulsar(3), starlord(3), bloodsoaked_counter(16), conch_of_dark_whispers
1:39.873 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power seething_rage, arcanic_pulsar(3), bloodsoaked_counter(16), conch_of_dark_whispers
1:41.109 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(18), conch_of_dark_whispers
1:42.311 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(18), conch_of_dark_whispers
1:43.799 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(21), conch_of_dark_whispers
1:45.289 default N sunfire Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2), bloodsoaked_counter(22)
1:46.458 default O moonfire Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2), bloodsoaked_counter(23)
1:47.627 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2), bloodsoaked_counter(25)
1:48.621 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), bloodsoaked_counter(25)
1:49.791 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(26)
1:50.756 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(26)
1:52.204 default R solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(27)
1:53.172 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(27)
1:54.307 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(28)
1:55.273 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(30)
1:56.719 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(30)
1:58.169 default P stellar_flare Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3), bloodsoaked_counter(30)
1:59.305 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3), bloodsoaked_counter(30), conch_of_dark_whispers
2:00.271 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(7), solar_empowerment(2), bloodsoaked_counter(31), conch_of_dark_whispers
2:01.509 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord, bloodsoaked_counter(33), conch_of_dark_whispers
2:02.531 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, bloodsoaked_counter(33), conch_of_dark_whispers
2:04.064 default N sunfire Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord, bloodsoaked_counter(33), conch_of_dark_whispers
2:05.266 default G use_items Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord, bloodsoaked_counter(33), conch_of_dark_whispers
2:05.266 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord, bloodsoaked_counter(33), conch_of_dark_whispers, ignition_mages_fuse
2:06.246 default K starsurge Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, bloodsoaked_counter(33), conch_of_dark_whispers, ignition_mages_fuse
2:07.397 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), bloodsoaked_counter(34), conch_of_dark_whispers, ignition_mages_fuse
2:08.226 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(35), conch_of_dark_whispers, ignition_mages_fuse
2:09.465 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(36), conch_of_dark_whispers, ignition_mages_fuse(2)
2:10.402 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(37), conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.174 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(38), conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.330 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(39), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.239 default O moonfire Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(39), conch_of_dark_whispers, ignition_mages_fuse(2)
2:14.285 default R solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(39), conch_of_dark_whispers, ignition_mages_fuse(3)
2:15.138 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked, ignition_mages_fuse(3)
2:16.332 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked, ignition_mages_fuse(3)
2:17.529 default Q lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked, ignition_mages_fuse(4)
2:18.685 default R solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(3), bloodsoaked, ignition_mages_fuse(4)
2:19.457 default Q lunar_strike Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked, ignition_mages_fuse(4)
2:20.613 default R solar_wrath Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(2), solar_empowerment(3), bloodsoaked, ignition_mages_fuse(4)
2:21.453 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(2), solar_empowerment(2), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(5)
2:22.409 default N sunfire Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse(5)
2:23.338 default P stellar_flare Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, conch_of_dark_whispers, ignition_mages_fuse(5)
2:24.324 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(24), bloodsoaked_counter(2), conch_of_dark_whispers, ignition_mages_fuse(5)
2:25.104 default K starsurge Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(23), bloodsoaked_counter(4), conch_of_dark_whispers, ignition_mages_fuse(5)
2:26.025 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(22), bloodsoaked_counter(4), conch_of_dark_whispers
2:26.941 default Q lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(22), bloodsoaked_counter(4), conch_of_dark_whispers
2:28.317 default Q lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(20), bloodsoaked_counter(6), conch_of_dark_whispers
2:29.702 default K starsurge Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(19), bloodsoaked_counter(6), conch_of_dark_whispers
2:30.794 default O moonfire Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(18), bloodsoaked_counter(6), conch_of_dark_whispers
2:31.859 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(17), bloodsoaked_counter(9), conch_of_dark_whispers
2:32.769 default Q lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16), bloodsoaked_counter(9), conch_of_dark_whispers
2:34.136 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25), bloodsoaked_counter(9), conch_of_dark_whispers
2:35.177 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24), bloodsoaked_counter(10), conch_of_dark_whispers
2:36.063 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), bloodsoaked_counter(10), conch_of_dark_whispers
2:37.395 default Q lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), bloodsoaked_counter(11)
2:38.733 default R solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), overwhelming_power(21), bloodsoaked_counter(11)
2:39.628 default N sunfire Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(20), bloodsoaked_counter(12)
2:40.686 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(19), bloodsoaked_counter(12)
2:41.589 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar(6), solar_empowerment, overwhelming_power(18), bloodsoaked_counter(14)
2:42.749 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(17), bloodsoaked_counter(15)
2:43.880 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(16), bloodsoaked_counter(15)
2:44.819 default P stellar_flare Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(15), bloodsoaked_counter(16)
2:45.927 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(14), bloodsoaked_counter(18)
2:47.341 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(12), bloodsoaked_counter(20)
2:48.291 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(11), bloodsoaked_counter(21)
2:49.412 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(10), bloodsoaked_counter(23)
2:50.223 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(9), bloodsoaked_counter(23)
2:51.438 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8), bloodsoaked_counter(24)
2:52.399 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(7), bloodsoaked_counter(24)
2:53.220 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6), bloodsoaked_counter(24)
2:54.451 default M moonfire Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(5), bloodsoaked_counter(24)
2:55.421 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(4), bloodsoaked_counter(25)
2:56.847 default N sunfire Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(3), bloodsoaked_counter(26), conch_of_dark_whispers
2:57.970 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2), bloodsoaked_counter(27), conch_of_dark_whispers
2:58.930 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power, bloodsoaked_counter(29), conch_of_dark_whispers
2:59.892 default Q lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25), bloodsoaked_counter(30), conch_of_dark_whispers
3:01.217 default R solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(23), bloodsoaked_counter(31), conch_of_dark_whispers
3:02.262 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar, torrent_of_elements, overwhelming_power(22), bloodsoaked_counter(31), conch_of_dark_whispers
3:03.407 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(21), bloodsoaked_counter(32), conch_of_dark_whispers
3:04.523 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(20), bloodsoaked_counter(34), conch_of_dark_whispers
3:05.908 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19), bloodsoaked_counter(34), conch_of_dark_whispers
3:07.298 default I celestial_alignment Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(3), celestial_alignment, solar_empowerment(3), starlord(2), overwhelming_power(17), bloodsoaked_counter(35), conch_of_dark_whispers
3:08.254 default E potion Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(3), celestial_alignment, solar_empowerment(3), starlord(2), overwhelming_power(16), bloodsoaked_counter(35), conch_of_dark_whispers
3:08.254 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(3), celestial_alignment, solar_empowerment(3), starlord(2), overwhelming_power(16), bloodsoaked_counter(35), conch_of_dark_whispers, battle_potion_of_intellect
3:08.254 default H blood_of_the_enemy Fluffy_Pillow 83.5/100: 84% astral_power berserking, arcanic_pulsar(3), celestial_alignment, solar_empowerment(3), starlord(2), overwhelming_power(16), bloodsoaked_counter(35), conch_of_dark_whispers, battle_potion_of_intellect
3:09.124 default R solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, solar_empowerment(3), starlord(2), overwhelming_power(15), bloodsoaked_counter(38), conch_of_dark_whispers, battle_potion_of_intellect
3:09.878 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(15), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:10.692 default P stellar_flare Fluffy_Pillow 57.0/100: 57% astral_power berserking, seething_rage, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(14), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:11.488 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power berserking, seething_rage, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(13), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:12.244 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power berserking, seething_rage, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12), bloodsoaked, battle_potion_of_intellect
3:13.046 default O moonfire Fluffy_Pillow 38.5/100: 39% astral_power berserking, seething_rage, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(11), bloodsoaked, battle_potion_of_intellect
3:13.851 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(11), bloodsoaked, battle_potion_of_intellect
3:14.607 default Q lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), bloodsoaked, battle_potion_of_intellect
3:15.636 default N sunfire Fluffy_Pillow 67.0/100: 67% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(9), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:16.446 default R solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(8), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:17.199 default K starsurge Fluffy_Pillow 79.0/100: 79% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(7), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:18.015 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(6), conch_of_dark_whispers, battle_potion_of_intellect
3:18.770 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6), bloodsoaked_counter, conch_of_dark_whispers, battle_potion_of_intellect
3:19.892 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(5), bloodsoaked_counter(3), conch_of_dark_whispers, battle_potion_of_intellect
3:20.647 default Q lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(4), bloodsoaked_counter(3), conch_of_dark_whispers, battle_potion_of_intellect
3:21.885 default R solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(6), celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(3), bloodsoaked_counter(4), conch_of_dark_whispers, battle_potion_of_intellect
3:22.717 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar(6), celestial_alignment, torrent_of_elements, overwhelming_power(2), bloodsoaked_counter(4), conch_of_dark_whispers, battle_potion_of_intellect
3:23.787 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power, bloodsoaked_counter(5), conch_of_dark_whispers, battle_potion_of_intellect
3:24.673 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord, torrent_of_elements, bloodsoaked_counter(5), conch_of_dark_whispers, battle_potion_of_intellect
3:25.720 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), bloodsoaked_counter(5), conch_of_dark_whispers, battle_potion_of_intellect
3:26.583 default L sunfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(2), bloodsoaked_counter(6), conch_of_dark_whispers, battle_potion_of_intellect
3:27.599 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), lunar_empowerment(2), starlord(2), bloodsoaked_counter(9), conch_of_dark_whispers, battle_potion_of_intellect
3:29.088 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(2), bloodsoaked_counter(11), conch_of_dark_whispers, battle_potion_of_intellect
3:30.257 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(12), conch_of_dark_whispers, battle_potion_of_intellect
3:31.097 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power celestial_alignment, lunar_empowerment(3), starlord(3), bloodsoaked_counter(13), battle_potion_of_intellect
3:32.357 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), bloodsoaked_counter(13), battle_potion_of_intellect
3:33.344 default P stellar_flare Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked_counter(13)
3:34.332 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked_counter(13), conch_of_dark_whispers
3:35.171 default M moonfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), bloodsoaked_counter(13), conch_of_dark_whispers
3:36.160 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, lunar_empowerment(3), starlord(3), bloodsoaked_counter(14), conch_of_dark_whispers
3:37.608 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(14), conch_of_dark_whispers
3:38.744 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(14), conch_of_dark_whispers
3:40.191 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(14), conch_of_dark_whispers
3:41.638 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(16), conch_of_dark_whispers
3:43.086 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(2), solar_empowerment(2), torrent_of_elements, bloodsoaked_counter(17), conch_of_dark_whispers
3:44.323 default R solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, bloodsoaked_counter(18), conch_of_dark_whispers
3:45.345 default N sunfire Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, bloodsoaked_counter(19), conch_of_dark_whispers
3:46.547 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, bloodsoaked_counter(22), conch_of_dark_whispers
3:48.079 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, torrent_of_elements, bloodsoaked_counter(23), conch_of_dark_whispers
3:49.101 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(3), solar_empowerment, starlord, torrent_of_elements, bloodsoaked_counter(24), conch_of_dark_whispers
3:50.304 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(26)
3:51.793 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(26)
3:52.787 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(25), bloodsoaked_counter(26)
3:54.149 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(23), bloodsoaked_counter(28)
3:55.226 default Q lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), bloodsoaked_counter(28)
3:56.563 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(21), bloodsoaked_counter(29)
3:57.458 default O moonfire Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(20), bloodsoaked_counter(30)
3:58.514 default P stellar_flare Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(19), bloodsoaked_counter(30)
3:59.576 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(18), bloodsoaked_counter(30)
4:00.484 default Q lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), overwhelming_power(17), bloodsoaked_counter(31)
4:01.845 default R solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(25), bloodsoaked_counter(32)
4:02.728 default N sunfire Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(24), bloodsoaked_counter(33)
4:03.770 default K starsurge Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(5), overwhelming_power(23), bloodsoaked_counter(33)
4:04.910 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(22), bloodsoaked_counter(36)
4:06.325 default G use_items Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(6), solar_empowerment, starlord, overwhelming_power(20), bloodsoaked_counter(36)
4:06.325 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(6), solar_empowerment, starlord, overwhelming_power(20), bloodsoaked_counter(36), ignition_mages_fuse
4:07.400 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(19), bloodsoaked_counter(37), ignition_mages_fuse
4:08.734 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(2), overwhelming_power(18), bloodsoaked_counter(38), ignition_mages_fuse
4:09.629 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(17), bloodsoaked_counter(39), ignition_mages_fuse
4:10.681 default R solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(16), bloodsoaked, ignition_mages_fuse(2)
4:11.470 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), bloodsoaked, ignition_mages_fuse(2)
4:12.657 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), overwhelming_power(14), bloodsoaked, ignition_mages_fuse(2)
4:13.451 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13), bloodsoaked, ignition_mages_fuse(2)
4:14.644 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(12), bloodsoaked, ignition_mages_fuse(3)
4:15.414 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(11), bloodsoaked, ignition_mages_fuse(3)
4:16.189 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(10), bloodsoaked, ignition_mages_fuse(3)
4:17.101 default Q lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(9), bloodsoaked, ignition_mages_fuse(3)
4:18.267 default R solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(8), ignition_mages_fuse(3)
4:19.243 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(7), bloodsoaked_counter(2), ignition_mages_fuse(4)
4:20.187 default O moonfire Fluffy_Pillow 64.0/100: 64% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(6), bloodsoaked_counter(3), ignition_mages_fuse(4)
4:21.011 default P stellar_flare Fluffy_Pillow 68.0/100: 68% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(5), bloodsoaked_counter(3), ignition_mages_fuse(4)
4:21.839 default R solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(5), bloodsoaked_counter(3), ignition_mages_fuse(4)
4:22.594 default S sunfire Fluffy_Pillow 85.0/100: 85% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(4), bloodsoaked_counter(5), ignition_mages_fuse(5)
4:23.393 default J cancel_buff Fluffy_Pillow 88.5/100: 89% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(3), bloodsoaked_counter(7), ignition_mages_fuse(5)
4:23.393 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power celestial_alignment, lunar_empowerment, overwhelming_power(3), bloodsoaked_counter(7), ignition_mages_fuse(5)
4:24.267 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(2), bloodsoaked_counter(9), conch_of_dark_whispers, ignition_mages_fuse(5)
4:25.023 default Q lunar_strike Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord, torrent_of_elements, overwhelming_power, bloodsoaked_counter(9), conch_of_dark_whispers, ignition_mages_fuse(5)
4:26.112 default K starsurge Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar, lunar_empowerment(2), starlord, torrent_of_elements, bloodsoaked_counter(11), conch_of_dark_whispers, ignition_mages_fuse(5)
4:27.097 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(24), bloodsoaked_counter(12), conch_of_dark_whispers
4:28.464 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(23), bloodsoaked_counter(14), conch_of_dark_whispers
4:29.542 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), bloodsoaked_counter(16), conch_of_dark_whispers
4:30.877 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), bloodsoaked_counter(17), conch_of_dark_whispers
4:32.217 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), bloodsoaked_counter(18), conch_of_dark_whispers
4:33.568 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18), bloodsoaked_counter(19), conch_of_dark_whispers
4:34.633 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(17), bloodsoaked_counter(21), conch_of_dark_whispers
4:35.541 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16), bloodsoaked_counter(22), conch_of_dark_whispers
4:36.908 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15), bloodsoaked_counter(24), conch_of_dark_whispers
4:37.824 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(14), bloodsoaked_counter(24), conch_of_dark_whispers
4:38.903 default H blood_of_the_enemy Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13), bloodsoaked_counter(26), conch_of_dark_whispers
4:39.986 default N sunfire Fluffy_Pillow 7.5/100: 8% astral_power seething_rage, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12), bloodsoaked_counter(27)
4:41.073 default O moonfire Fluffy_Pillow 11.0/100: 11% astral_power seething_rage, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10), bloodsoaked_counter(28)
4:42.169 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power seething_rage, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9), bloodsoaked_counter(29)
4:43.569 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power seething_rage, arcanic_pulsar(5), solar_empowerment(2), overwhelming_power(8), bloodsoaked_counter(29), conch_of_dark_whispers
4:44.592 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(5), solar_empowerment, overwhelming_power(7), bloodsoaked_counter(32), conch_of_dark_whispers
4:45.617 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(5), overwhelming_power(6), bloodsoaked_counter(34), conch_of_dark_whispers
4:46.830 default P stellar_flare Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(5), bloodsoaked_counter(36), conch_of_dark_whispers
4:48.011 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(3), bloodsoaked_counter(36), conch_of_dark_whispers
4:49.527 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(6), solar_empowerment, starlord, overwhelming_power(2), bloodsoaked_counter(38), conch_of_dark_whispers
4:50.542 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(6), lunar_empowerment, starlord, overwhelming_power, bloodsoaked, conch_of_dark_whispers
4:51.656 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), bloodsoaked, conch_of_dark_whispers
4:53.040 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), bloodsoaked, conch_of_dark_whispers
4:54.423 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), bloodsoaked, conch_of_dark_whispers
4:55.346 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(7), starlord(2), bloodsoaked, conch_of_dark_whispers
4:56.432 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked, conch_of_dark_whispers
4:57.776 default N sunfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(24), bloodsoaked, conch_of_dark_whispers
4:58.750 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(23), bloodsoaked_counter, conch_of_dark_whispers
4:59.639 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(22), bloodsoaked_counter, conch_of_dark_whispers
5:00.976 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(21), bloodsoaked_counter(2), conch_of_dark_whispers
5:02.029 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(19), bloodsoaked_counter(3), conch_of_dark_whispers
5:03.091 default O moonfire Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(18), bloodsoaked_counter(4), conch_of_dark_whispers
5:04.155 default R solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(17), bloodsoaked_counter(5), conch_of_dark_whispers
5:05.224 default Q lunar_strike Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(16), bloodsoaked_counter(5), conch_of_dark_whispers
5:06.588 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8), overwhelming_power(15), bloodsoaked_counter(8), conch_of_dark_whispers
5:07.761 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(14), bloodsoaked_counter(8), conch_of_dark_whispers
5:08.606 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(13), bloodsoaked_counter(10), conch_of_dark_whispers
5:09.603 default P stellar_flare Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(12), bloodsoaked_counter(10), conch_of_dark_whispers
5:10.578 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(11), bloodsoaked_counter(10), conch_of_dark_whispers
5:11.554 default R solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(10), bloodsoaked_counter(13), conch_of_dark_whispers
5:12.365 default L sunfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(9), bloodsoaked_counter(14), conch_of_dark_whispers
5:13.322 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(8), bloodsoaked_counter(15), conch_of_dark_whispers
5:14.726 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(7), bloodsoaked_counter(17), conch_of_dark_whispers
5:16.137 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(5), bloodsoaked_counter(18), conch_of_dark_whispers
5:17.252 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(4), bloodsoaked_counter(19), conch_of_dark_whispers
5:18.678 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25), bloodsoaked_counter(20), conch_of_dark_whispers
5:20.004 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(23), bloodsoaked_counter(20), conch_of_dark_whispers
5:20.895 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(23), bloodsoaked_counter(21), conch_of_dark_whispers
5:21.941 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), bloodsoaked_counter(21), conch_of_dark_whispers
5:23.280 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(20), bloodsoaked_counter(22), conch_of_dark_whispers
5:24.180 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(19), bloodsoaked_counter(26), conch_of_dark_whispers
5:25.082 default O moonfire Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(18), bloodsoaked_counter(27), conch_of_dark_whispers
5:26.147 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(17), bloodsoaked_counter(29), conch_of_dark_whispers
5:27.215 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(4), overwhelming_power(16), bloodsoaked_counter(29), conch_of_dark_whispers
5:28.383 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), bloodsoaked_counter(30)
5:29.788 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(5), solar_empowerment, starlord, overwhelming_power(23), bloodsoaked_counter(30)
5:30.730 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), starlord, overwhelming_power(22), bloodsoaked_counter(31)
5:31.843 default N sunfire Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(21), bloodsoaked_counter(31)
5:32.926 default P stellar_flare Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(20), bloodsoaked_counter(34)
5:34.014 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(18), bloodsoaked_counter(35)
5:35.409 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(17), bloodsoaked_counter(37)
5:36.343 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(2), overwhelming_power(16), bloodsoaked_counter(37)
5:37.746 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(6), starlord(2), overwhelming_power(15), bloodsoaked_counter(37)
5:38.851 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(14), bloodsoaked_counter(37)
5:40.226 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(12), bloodsoaked_counter(38)
5:41.150 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(11), bloodsoaked_counter(10), bloodsoaked
5:42.167 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(10), bloodsoaked_counter(10), bloodsoaked
5:43.467 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(9), bloodsoaked_counter(10), bloodsoaked
5:44.336 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(8), bloodsoaked_counter(10), bloodsoaked

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="blood of the enemy"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

focusing iris : 41733 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
41733.3 41733.3 23.1 / 0.055% 4805.1 / 11.5% 4847.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.6 8.5 Astral Power 0.00% 60.7 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
focusing iris 41733
Heed My Call 310 (443) 0.7% (1.1%) 8.6 31.92sec 15476 0 Direct 8.6 9128 18254 10833 18.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.58 8.58 0.00 0.00 0.0000 0.0000 92958.13 92958.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.98 81.32% 9128.04 8921 9813 9125.87 0 9813 63699 63699 0.00
crit 1.60 18.68% 18253.94 17842 19626 14690.06 0 19626 29260 29260 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 133 0.3% 8.6 31.92sec 4643 0 Direct 8.6 3912 7826 4643 18.7%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.58 8.58 0.00 0.00 0.0000 0.0000 39844.39 39844.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.98 81.31% 3911.68 3823 4206 3911.57 0 4206 27294 27294 0.00
crit 1.60 18.69% 7826.07 7646 8411 6287.01 0 8411 12550 12550 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6160 14.8% 81.6 3.59sec 22614 18180 Direct 81.6 19050 38080 22613 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.61 81.61 0.00 0.00 1.2439 0.0000 1845508.36 1845508.36 0.00 18180.20 18180.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.33 81.27% 19050.06 10135 24211 19057.31 18358 20071 1263551 1263551 0.00
crit 15.28 18.73% 38079.71 20270 48422 38091.79 34750 43777 581958 581958 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2985 7.2% 14.2 21.29sec 62971 64757 Direct 14.2 3273 6548 3881 18.6%  
Periodic 233.6 3027 6049 3591 18.7% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.20 14.20 233.59 233.59 0.9725 1.2751 893971.28 893971.28 0.00 2868.39 64757.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.56 81.43% 3272.56 2981 4065 3274.11 3020 3580 37832 37832 0.00
crit 2.64 18.57% 6548.22 5963 8130 6167.96 0 8130 17262 17262 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 190.0 81.33% 3027.01 5 3785 3028.38 2946 3149 575100 575100 0.00
crit 43.6 18.67% 6049.30 41 7570 6052.14 5631 6568 263777 263777 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 961 2.3% 46.6 6.28sec 6174 0 Direct 46.6 5203 10391 6174 18.7%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.60 46.60 0.00 0.00 0.0000 0.0000 287702.80 287702.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.87 81.27% 5202.65 4769 6503 5205.16 4908 5625 197037 197037 0.00
crit 8.73 18.73% 10390.67 9539 13006 10387.72 0 13006 90666 90666 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3492 (5528) 8.4% (13.3%) 100.9 2.93sec 16420 18813 Direct 101.3 8703 17392 10325 18.7%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.86 101.34 0.00 0.00 0.8728 0.0000 1046329.39 1046329.39 0.00 18813.23 18813.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.42 81.33% 8703.14 7949 10838 8708.19 8405 9197 717306 717306 0.00
crit 18.92 18.67% 17391.84 15898 21676 17401.43 16020 19306 329023 329023 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2036 4.9% 78.5 3.74sec 7774 0 Direct 78.5 7774 0 7774 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.46 78.46 0.00 0.00 0.0000 0.0000 609893.14 609893.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.46 100.00% 7773.67 5962 16257 7777.64 6731 9096 609893 609893 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6855.95
  • base_dd_max:6855.95
  • base_dd_mult:1.00
 
Starsurge 14247 34.2% 64.4 4.70sec 66230 65857 Direct 64.2 56037 111971 66455 18.6%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.42 64.20 0.00 0.00 1.0057 0.0000 4266379.70 4266379.70 0.00 65857.49 65857.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.24 81.37% 56037.43 51347 69612 56062.21 53938 59188 2927530 2927530 0.00
crit 11.96 18.63% 111970.78 102695 139223 112015.93 102695 129315 1338850 1338850 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1938 4.6% 12.8 23.56sec 45334 46274 Direct 12.8 2790 5580 3306 18.5%  
Periodic 231.2 1961 3920 2328 18.7% 98.5%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.80 12.80 231.18 231.18 0.9797 1.2772 580416.72 580416.72 0.00 1885.64 46274.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.44 81.53% 2790.36 2570 3504 2792.11 2570 3071 29127 29127 0.00
crit 2.36 18.47% 5580.04 5140 7009 5153.78 0 7009 13195 13195 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 187.9 81.29% 1961.11 1 2453 1962.02 1908 2045 368557 368557 0.00
crit 43.2 18.71% 3920.44 36 4906 3921.96 3699 4260 169538 169538 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6160 14.7% 94.5 2.97sec 19424 0 Direct 94.5 16385 32773 19424 18.5%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.47 94.47 0.00 0.00 0.0000 0.0000 1835008.13 1835008.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.96 81.46% 16385.30 16021 17623 16385.23 16021 17227 1260951 1260951 0.00
crit 17.52 18.54% 32773.38 32042 35246 32772.75 32042 35246 574057 574057 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3312 7.9% 17.6 17.01sec 56246 57268 Direct 17.6 4498 8995 5337 18.7%  
Periodic 232.7 3251 6495 3859 18.7% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.64 17.64 232.69 232.69 0.9821 1.2759 991996.11 991996.11 0.00 3156.99 57267.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.34 81.33% 4497.56 4112 5607 4498.98 4179 4865 64511 64511 0.00
crit 3.29 18.67% 8995.43 8225 11214 8727.47 0 11214 29623 29623 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 189.1 81.27% 3250.85 3 4065 3252.32 3158 3385 614725 614725 0.00
crit 43.6 18.73% 6494.85 21 8130 6497.77 6102 7010 283137 283137 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
focusing iris
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.61sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.43sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8717 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.6 56.6 42.1sec 4.7sec 93.40% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.31%
  • arcanic_pulsar_2:11.32%
  • arcanic_pulsar_3:11.59%
  • arcanic_pulsar_4:10.79%
  • arcanic_pulsar_5:12.53%
  • arcanic_pulsar_6:11.05%
  • arcanic_pulsar_7:11.78%
  • arcanic_pulsar_8:13.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.4sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.6sec 182.6sec 8.11% 8.35% 0.0(0.0) 2.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 7.9 0.0 40.0sec 40.0sec 26.67% 33.04% 0.0(0.0) 7.7

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.9sec 45.5sec 23.68% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Focused Energy 1.0 382.3 0.0sec 0.8sec 100.00% 99.73% 375.3(375.3) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_focused_energy
  • max_stacks:10
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:35.52

Stack Uptimes

  • focused_energy_3:0.41%
  • focused_energy_4:0.31%
  • focused_energy_5:0.40%
  • focused_energy_6:0.21%
  • focused_energy_7:0.20%
  • focused_energy_8:0.20%
  • focused_energy_9:0.19%
  • focused_energy_10:98.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295248
  • name:Focused Energy
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc295246=Your damaging spells and abilities grant you {$s2=0} Haste for {$295248d=4 seconds}, stacking up to {$295248u=10} times. This Haste is lost if you stop using spells or abilities against the initial target.$?a295252[ When you have no stacks of Focused Energy, generate {$s1=1} stacks from your first damaging spell or ability.][]}
  • max_stacks:10
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.23% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.84%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 37.0 47.8 8.2sec 3.6sec 81.65% 99.73% 2.1(2.1) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.99%
  • lunar_empowerment_2:30.81%
  • lunar_empowerment_3:14.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.8 63.5sec 32.5sec 49.63% 0.00% 3.8(52.4) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.40%
  • overwhelming_power_2:1.44%
  • overwhelming_power_3:1.48%
  • overwhelming_power_4:1.52%
  • overwhelming_power_5:1.57%
  • overwhelming_power_6:1.62%
  • overwhelming_power_7:1.66%
  • overwhelming_power_8:1.72%
  • overwhelming_power_9:1.77%
  • overwhelming_power_10:1.82%
  • overwhelming_power_11:1.88%
  • overwhelming_power_12:1.93%
  • overwhelming_power_13:1.99%
  • overwhelming_power_14:2.05%
  • overwhelming_power_15:2.11%
  • overwhelming_power_16:2.18%
  • overwhelming_power_17:2.25%
  • overwhelming_power_18:2.32%
  • overwhelming_power_19:2.39%
  • overwhelming_power_20:2.46%
  • overwhelming_power_21:2.54%
  • overwhelming_power_22:2.62%
  • overwhelming_power_23:2.71%
  • overwhelming_power_24:2.78%
  • overwhelming_power_25:1.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 27.5 53.2 10.9sec 3.7sec 84.42% 77.55% 0.2(0.2) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:29.62%
  • solar_empowerment_2:38.82%
  • solar_empowerment_3:15.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 49.1 20.2sec 4.7sec 97.93% 93.14% 18.8(18.8) 11.3

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:13.29%
  • starlord_2:21.63%
  • starlord_3:63.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 60.7sec 45.6sec 23.74% 0.00% 1.1(1.1) 4.1

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.74%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
focusing iris
starsurge Astral Power 64.4 2576.7 40.0 40.0 1655.8
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 101.86 814.85 (32.10%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.15%) 40.00 0.00 0.00%
sunfire Astral Power 17.64 52.91 (2.08%) 3.00 0.00 0.00%
shooting_stars Astral Power 46.60 186.38 (7.34%) 4.00 0.00 0.00%
moonfire Astral Power 14.20 42.59 (1.68%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.80 102.42 (4.03%) 8.00 0.00 0.00%
lunar_strike Astral Power 81.61 979.27 (38.57%) 12.00 0.07 0.01%
natures_balance Astral Power 400.36 200.18 (7.88%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.69 80.23 (3.16%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.47 8.59
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.81 0.00 67.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data focusing iris Fight Length
Count 11043
Mean 299.90
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data focusing iris Damage Per Second
Count 11043
Mean 41733.29
Minimum 38316.23
Maximum 47107.44
Spread ( max - min ) 8791.21
Range [ ( max - min ) / 2 * 100% ] 10.53%
Standard Deviation 1237.3388
5th Percentile 39796.39
95th Percentile 43847.27
( 95th Percentile - 5th Percentile ) 4050.88
Mean Distribution
Standard Deviation 11.7746
95.00% Confidence Intervall ( 41710.21 - 41756.37 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 34
0.1% Error 3377
0.1 Scale Factor Error with Delta=300 13070
0.05 Scale Factor Error with Delta=300 52279
0.01 Scale Factor Error with Delta=300 1306956
Priority Target DPS
Sample Data focusing iris Priority Target Damage Per Second
Count 11043
Mean 41733.29
Minimum 38316.23
Maximum 47107.44
Spread ( max - min ) 8791.21
Range [ ( max - min ) / 2 * 100% ] 10.53%
Standard Deviation 1237.3388
5th Percentile 39796.39
95th Percentile 43847.27
( 95th Percentile - 5th Percentile ) 4050.88
Mean Distribution
Standard Deviation 11.7746
95.00% Confidence Intervall ( 41710.21 - 41756.37 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 34
0.1% Error 3377
0.1 Scale Factor Error with Delta=300 13070
0.05 Scale Factor Error with Delta=300 52279
0.01 Scale Factor Error with Delta=300 1306956
DPS(e)
Sample Data focusing iris Damage Per Second (Effective)
Count 11043
Mean 41733.29
Minimum 38316.23
Maximum 47107.44
Spread ( max - min ) 8791.21
Range [ ( max - min ) / 2 * 100% ] 10.53%
Damage
Sample Data focusing iris Damage
Count 11043
Mean 12490008.15
Minimum 9595813.44
Maximum 15468626.03
Spread ( max - min ) 5872812.59
Range [ ( max - min ) / 2 * 100% ] 23.51%
DTPS
Sample Data focusing iris Damage Taken Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data focusing iris Healing Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data focusing iris Healing Per Second (Effective)
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data focusing iris Heal
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data focusing iris Healing Taken Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data focusing iris Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data focusing irisTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data focusing iris Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 3.11 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 64.42 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 2.66 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 2.83 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 14.65 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
N 11.36 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.80 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 81.97 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 101.12 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.32 sunfire

Sample Sequence

0123456789ACDJNMOHFGJQJQPQPJQPQJQPMQNQPQRJOJQKPJPPPQQQPJQJQPQPQLIJJPMPJOQPJQPPPQPQQJJMNPJQPOQPQQJQPQIJQKPJNPPJQPJOQPMPQJJQPNQJQPJQPPMQQOQQJQJQJGQPLJPPPJMPQQQQQQJOJPPQQJNPMQQJPQQQQPJQJQOQJMPNPJPPQQQQQJJPMPQHEFJOJNQPQJQPQPQPJMQPJQPJQPJOLPJPPPMQJPJQPQPQJQPJNOQMPPJGQPJQPKPJQPPJQNPOPQQJPJPMQQJPQQQJPPNQQJOMPPJQPJQPLPJQPQQQJMPOQJPQQJPQQNQQMQJPJPQQJOPQQQPQQIJJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask focusing iris 58.0/100: 58% astral_power
Pre precombat 1 food focusing iris 58.0/100: 58% astral_power
Pre precombat 2 augmentation focusing iris 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power focused_energy(3), battle_potion_of_intellect
0:01.224 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, focused_energy(3), battle_potion_of_intellect
0:02.139 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, focused_energy(4), battle_potion_of_intellect
0:03.048 default O stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, focused_energy(5), battle_potion_of_intellect
0:03.955 default H celestial_alignment Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(7), battle_potion_of_intellect
0:04.739 default F berserking Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(8), battle_potion_of_intellect
0:04.739 default G use_items Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(8), battle_potion_of_intellect
0:04.739 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(8), battle_potion_of_intellect, ignition_mages_fuse
0:05.494 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(9), battle_potion_of_intellect, ignition_mages_fuse
0:06.248 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:07.002 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:07.757 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:08.566 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:09.320 default P lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.100 default J starsurge Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.855 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.609 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.388 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.142 default J starsurge Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:13.897 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.652 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(24), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.406 default M sunfire Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.161 default Q solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.915 default N moonfire Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.669 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(21), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.422 default P lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(20), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.177 default Q solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(19), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.933 default R sunfire Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(19), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.688 default J starsurge Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overwhelming_power(18), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.444 default O stellar_flare Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(17), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.199 default J starsurge Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(16), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.955 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(16), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.712 default K sunfire Fluffy_Pillow 28.5/100: 28% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(15), focused_energy(10), ignition_mages_fuse(5)
0:24.465 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(14), focused_energy(10), ignition_mages_fuse(5)
0:25.337 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(13), focused_energy(10)
0:26.163 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(12), focused_energy(10)
0:27.188 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11), focused_energy(10)
0:28.217 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10), focused_energy(10)
0:29.248 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(9), focused_energy(10)
0:30.001 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(8), focused_energy(10)
0:30.754 default Q solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(8), focused_energy(10)
0:31.570 default P lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(7), focused_energy(10)
0:32.613 default J starsurge Fluffy_Pillow 89.5/100: 90% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(6), focused_energy(10), conch_of_dark_whispers
0:33.435 default Q solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(5), focused_energy(10), conch_of_dark_whispers
0:34.189 default J starsurge Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(4), focused_energy(10), conch_of_dark_whispers
0:34.945 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(4), focused_energy(10), conch_of_dark_whispers
0:35.699 default P lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(3), focused_energy(10), conch_of_dark_whispers
0:36.618 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(2), focused_energy(10), conch_of_dark_whispers
0:37.374 default P lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power, focused_energy(10), conch_of_dark_whispers
0:38.299 default Q solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power bloodlust, arcanic_pulsar, celestial_alignment, starlord(3), focused_energy(10), conch_of_dark_whispers
0:39.054 default L moonfire Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, arcanic_pulsar, celestial_alignment, starlord(3), focused_energy(10), conch_of_dark_whispers
0:39.809 default I cancel_buff Fluffy_Pillow 89.5/100: 90% astral_power bloodlust, arcanic_pulsar, starlord(3), focused_energy(10), conch_of_dark_whispers
0:39.809 default J starsurge Fluffy_Pillow 89.5/100: 90% astral_power bloodlust, arcanic_pulsar, focused_energy(10), conch_of_dark_whispers
0:40.723 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, focused_energy(10), conch_of_dark_whispers
0:41.612 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers
0:43.039 default M sunfire Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers
0:44.161 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers
0:45.588 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers
0:46.709 default O stellar_flare Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers
0:47.800 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers
0:48.724 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
0:50.112 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
0:51.202 default Q solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers
0:52.129 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
0:53.516 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
0:54.904 default P lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
0:56.293 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), focused_energy(10)
0:57.221 default P lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10)
0:58.609 default Q solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), focused_energy(10)
0:59.535 default Q solar_wrath Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(5), starlord(3), focused_energy(10)
1:00.624 default J starsurge Fluffy_Pillow 98.0/100: 98% astral_power arcanic_pulsar(5), focused_energy(10)
1:01.811 default J starsurge Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
1:02.964 default M sunfire Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
1:04.083 default N moonfire Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
1:05.204 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
1:06.630 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
1:07.750 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10)
1:08.676 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10)
1:10.064 default O stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10)
1:11.153 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10)
1:12.078 default P lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
1:13.465 default Q solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), focused_energy(10)
1:14.391 default Q solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), focused_energy(10)
1:15.317 default J starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10)
1:16.407 default Q solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10)
1:17.212 default P lunar_strike Fluffy_Pillow 75.0/100: 75% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10)
1:18.419 default Q solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10)
1:19.225 default I cancel_buff Fluffy_Pillow 96.5/100: 97% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10)
1:19.225 default J starsurge Fluffy_Pillow 96.5/100: 97% astral_power celestial_alignment, lunar_empowerment(2), focused_energy(10)
1:20.258 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, focused_energy(10)
1:21.113 default K sunfire Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord, torrent_of_elements, focused_energy(10)
1:22.115 default P lunar_strike Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar, lunar_empowerment(3), starlord, torrent_of_elements, focused_energy(10)
1:23.583 default J starsurge Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, focused_energy(10), conch_of_dark_whispers
1:24.737 default N moonfire Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
1:25.858 default P lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
1:27.286 default P lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
1:28.712 default J starsurge Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
1:29.833 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
1:30.761 default P lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
1:32.149 default J starsurge Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
1:33.238 default O stellar_flare Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
1:34.328 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
1:35.253 default P lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
1:36.639 default M sunfire Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
1:37.728 default P lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
1:39.115 default Q solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), focused_energy(10)
1:40.042 default J starsurge Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar(4), solar_empowerment, focused_energy(10)
1:41.229 default J starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, focused_energy(10)
1:42.383 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), focused_energy(10)
1:43.334 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
1:44.762 default N moonfire Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), focused_energy(10)
1:45.883 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), focused_energy(10), conch_of_dark_whispers
1:46.838 default J starsurge Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25), focused_energy(10), conch_of_dark_whispers
1:47.866 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24), focused_energy(10), conch_of_dark_whispers
1:48.720 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), focused_energy(10), conch_of_dark_whispers
1:50.002 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), focused_energy(10), conch_of_dark_whispers
1:51.015 default Q solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20), focused_energy(10), conch_of_dark_whispers
1:51.880 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20), focused_energy(10), conch_of_dark_whispers
1:53.174 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18), focused_energy(10), conch_of_dark_whispers
1:54.476 default M sunfire Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), overwhelming_power(17), focused_energy(10), conch_of_dark_whispers
1:55.505 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), overwhelming_power(16), focused_energy(10), conch_of_dark_whispers
1:56.381 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(15), focused_energy(10), conch_of_dark_whispers
1:57.260 default O stellar_flare Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(14), focused_energy(10), conch_of_dark_whispers
1:58.297 default Q solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(13), focused_energy(10), conch_of_dark_whispers
1:59.183 default Q solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(12), focused_energy(10), conch_of_dark_whispers
2:00.227 default J starsurge Fluffy_Pillow 99.0/100: 99% astral_power arcanic_pulsar(8), overwhelming_power(11), focused_energy(10), conch_of_dark_whispers
2:01.371 default Q solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(10), focused_energy(10)
2:02.195 default J starsurge Fluffy_Pillow 80.0/100: 80% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(9), focused_energy(10)
2:03.166 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(8), focused_energy(10)
2:03.971 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(8), focused_energy(10), conch_of_dark_whispers
2:04.919 default G use_items Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(7), focused_energy(10), conch_of_dark_whispers
2:04.919 default Q solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(7), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
2:05.675 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(6), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
2:06.810 default L moonfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(5), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
2:07.703 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(4), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
2:08.736 default P lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
2:10.054 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power, focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.328 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.608 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.613 default M sunfire Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
2:14.580 default P lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
2:15.811 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.634 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.456 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(24), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
2:18.324 default Q solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(23), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.196 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(22), focused_energy(10), ignition_mages_fuse(4)
2:20.068 default Q solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(21), focused_energy(10), ignition_mages_fuse(4)
2:20.945 default J starsurge Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(4), overwhelming_power(21), focused_energy(10), ignition_mages_fuse(5)
2:21.867 default O stellar_flare Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(25), focused_energy(10), ignition_mages_fuse(5)
2:22.754 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), focused_energy(10), ignition_mages_fuse(5)
2:23.643 default P lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23), focused_energy(10), ignition_mages_fuse(5)
2:24.748 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(22), focused_energy(10), ignition_mages_fuse(5)
2:25.853 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(21), focused_energy(10)
2:26.738 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(20), focused_energy(10)
2:27.628 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(6), starlord(2), overwhelming_power(19), focused_energy(10)
2:28.678 default N moonfire Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18), focused_energy(10)
2:29.703 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(17), focused_energy(10)
2:31.010 default M sunfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(15), focused_energy(10)
2:32.043 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(14), focused_energy(10)
2:32.926 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(14), focused_energy(10)
2:33.808 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(13), focused_energy(10)
2:34.849 default P lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(12), focused_energy(10), conch_of_dark_whispers
2:36.178 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(10), focused_energy(10), conch_of_dark_whispers
2:37.072 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(9), focused_energy(10), conch_of_dark_whispers
2:38.127 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(8), focused_energy(10), conch_of_dark_whispers
2:39.186 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(7), focused_energy(10), conch_of_dark_whispers
2:40.249 default P lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(6), focused_energy(10), conch_of_dark_whispers
2:41.608 default J starsurge Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(8), torrent_of_elements, overwhelming_power(5), focused_energy(10), conch_of_dark_whispers
2:42.776 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(4), focused_energy(10), conch_of_dark_whispers
2:43.618 default J starsurge Fluffy_Pillow 56.0/100: 56% astral_power celestial_alignment, lunar_empowerment, starlord, torrent_of_elements, overwhelming_power(3), focused_energy(10), conch_of_dark_whispers
2:44.611 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(2), focused_energy(10), conch_of_dark_whispers
2:45.433 default O stellar_flare Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power, focused_energy(10), conch_of_dark_whispers
2:46.405 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
2:47.379 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
2:48.353 default M sunfire Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
2:49.441 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
2:50.828 default N moonfire Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
2:51.917 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
2:53.303 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
2:54.392 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
2:55.779 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
2:57.165 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3), torrent_of_elements, focused_energy(10)
2:58.091 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
2:59.017 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
2:59.943 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(3), starlord(3), focused_energy(10)
3:01.033 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, focused_energy(10)
3:02.123 default J starsurge Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(3), torrent_of_elements, focused_energy(10)
3:03.309 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, focused_energy(10)
3:04.462 default P lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10)
3:05.888 default M sunfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10)
3:07.010 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10)
3:08.438 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10)
3:09.390 default H celestial_alignment Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(2), torrent_of_elements, focused_energy(10)
3:10.365 default E potion Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(2), torrent_of_elements, focused_energy(10)
3:10.365 default F berserking Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(2), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:10.365 default J starsurge Fluffy_Pillow 86.5/100: 87% astral_power berserking, arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(2), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:11.251 default O stellar_flare Fluffy_Pillow 47.5/100: 48% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:12.115 default J starsurge Fluffy_Pillow 56.0/100: 56% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:12.977 default N moonfire Fluffy_Pillow 20.5/100: 21% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:13.841 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:14.597 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:15.694 default Q solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:16.449 default J starsurge Fluffy_Pillow 57.5/100: 57% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:17.313 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power berserking, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:18.069 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power berserking, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:19.167 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power berserking, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:19.922 default P lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power berserking, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:21.021 default Q solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power berserking, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:21.775 default P lunar_strike Fluffy_Pillow 73.5/100: 74% astral_power berserking, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:22.873 default J starsurge Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:23.906 default M sunfire Fluffy_Pillow 62.5/100: 63% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:24.909 default Q solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:25.763 default P lunar_strike Fluffy_Pillow 75.0/100: 75% astral_power celestial_alignment, lunar_empowerment(3), starlord, torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:27.040 default J starsurge Fluffy_Pillow 88.0/100: 88% astral_power celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:28.043 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:28.870 default P lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:30.112 default J starsurge Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(24), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:31.007 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:31.761 default P lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(23), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:32.876 default J starsurge Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(22), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:33.754 default O stellar_flare Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(21), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:34.636 default L moonfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(20), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:35.520 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(19), focused_energy(10), conch_of_dark_whispers
3:36.821 default J starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(18), focused_energy(10), conch_of_dark_whispers
3:37.845 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(17), focused_energy(10), conch_of_dark_whispers
3:39.151 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15), focused_energy(10), conch_of_dark_whispers
3:40.465 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14), focused_energy(10), conch_of_dark_whispers
3:41.784 default M sunfire Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(13), focused_energy(10), conch_of_dark_whispers
3:42.825 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(12), focused_energy(10), conch_of_dark_whispers
3:43.714 default J starsurge Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, overwhelming_power(11), focused_energy(10), conch_of_dark_whispers
3:44.857 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(10), focused_energy(10), conch_of_dark_whispers
3:46.273 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(8), focused_energy(10)
3:47.392 default Q solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(7), focused_energy(10)
3:48.322 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(6), focused_energy(10), conch_of_dark_whispers
3:49.719 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(5), focused_energy(10), conch_of_dark_whispers
3:50.654 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(4), focused_energy(10), conch_of_dark_whispers
3:52.062 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(2), overwhelming_power(2), focused_energy(10), conch_of_dark_whispers
3:53.008 default J starsurge Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power, focused_energy(10), conch_of_dark_whispers
3:54.128 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers
3:55.054 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
3:56.441 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
3:57.531 default N moonfire Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers
3:58.620 default O stellar_flare Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers
3:59.710 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers
4:00.635 default M sunfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
4:01.725 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
4:03.112 default P lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10)
4:04.499 default J starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), focused_energy(10)
4:05.687 default G use_items Fluffy_Pillow 29.5/100: 30% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord, focused_energy(10)
4:05.687 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord, focused_energy(10), ignition_mages_fuse
4:06.506 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, focused_energy(10), ignition_mages_fuse
4:07.731 default J starsurge Fluffy_Pillow 51.0/100: 51% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, focused_energy(10), ignition_mages_fuse
4:08.694 default Q solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), focused_energy(10), ignition_mages_fuse
4:09.488 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), focused_energy(10), ignition_mages_fuse
4:10.677 default K sunfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10), ignition_mages_fuse(2)
4:11.576 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10), ignition_mages_fuse(2)
4:12.892 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10), ignition_mages_fuse(2)
4:13.926 default Q solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10), ignition_mages_fuse(3)
4:14.749 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), ignition_mages_fuse(3)
4:15.980 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), ignition_mages_fuse(3)
4:17.212 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), focused_energy(10), ignition_mages_fuse(3)
4:18.179 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10), ignition_mages_fuse(4)
4:18.972 default N moonfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), ignition_mages_fuse(4)
4:19.905 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), ignition_mages_fuse(4)
4:21.092 default O stellar_flare Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), ignition_mages_fuse(4)
4:22.023 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), ignition_mages_fuse(5)
4:23.169 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), ignition_mages_fuse(5)
4:23.934 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), ignition_mages_fuse(5)
4:24.700 default J starsurge Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(3), torrent_of_elements, focused_energy(10), ignition_mages_fuse(5)
4:25.681 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, focused_energy(10), ignition_mages_fuse(5)
4:26.893 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(4), solar_empowerment, starlord, torrent_of_elements, focused_energy(10)
4:28.047 default P lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10)
4:29.470 default M sunfire Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10)
4:30.591 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10)
4:31.543 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), torrent_of_elements, focused_energy(10)
4:32.495 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(5), starlord(2), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
4:33.616 default P lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
4:35.001 default Q solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
4:35.927 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
4:37.017 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
4:38.107 default J starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
4:39.196 default P lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
4:40.585 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
4:41.972 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
4:43.060 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
4:43.986 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers
4:45.075 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(7), lunar_empowerment, torrent_of_elements, focused_energy(10), conch_of_dark_whispers
4:46.262 default O stellar_flare Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, focused_energy(10), conch_of_dark_whispers
4:47.416 default M sunfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, focused_energy(10)
4:48.571 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, focused_energy(10)
4:50.038 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
4:51.507 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(8), solar_empowerment, starlord, torrent_of_elements, focused_energy(10)
4:52.658 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10)
4:53.485 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, focused_energy(10)
4:54.726 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, focused_energy(10)
4:55.700 default Q solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
4:56.507 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25), focused_energy(10)
4:57.615 default L moonfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), focused_energy(10)
4:58.487 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), focused_energy(10)
4:59.768 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), focused_energy(10)
5:00.776 default Q solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(21), focused_energy(10)
5:01.638 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), focused_energy(10)
5:02.935 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), focused_energy(10)
5:03.801 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18), focused_energy(10)
5:04.674 default Q solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, overwhelming_power(17), focused_energy(10)
5:05.702 default J starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(2), torrent_of_elements, overwhelming_power(16), focused_energy(10)
5:06.826 default M sunfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(15), focused_energy(10)
5:07.923 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(14), focused_energy(10)
5:09.322 default O stellar_flare Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(3), solar_empowerment, starlord, overwhelming_power(12), focused_energy(10)
5:10.427 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), solar_empowerment, starlord, overwhelming_power(11), focused_energy(10)
5:11.372 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(3), starlord, overwhelming_power(10), focused_energy(10)
5:12.485 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(9), focused_energy(10)
5:13.868 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), overwhelming_power(8), focused_energy(10)
5:14.796 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(4), starlord(2), overwhelming_power(7), focused_energy(10)
5:15.887 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(4), starlord(2), overwhelming_power(6), focused_energy(10)
5:16.982 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(5), focused_energy(10)
5:18.344 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(3), focused_energy(10)
5:19.262 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(2), focused_energy(10)
5:20.345 default N moonfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power, focused_energy(10)
5:21.430 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), starlord(3), focused_energy(10)
5:22.520 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(5), starlord(3), focused_energy(10)
5:23.608 default M sunfire Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(5), starlord(3), focused_energy(10)
5:24.697 default Q solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(5), starlord(3), focused_energy(10)
5:25.787 default J starsurge Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(5), focused_energy(10)
5:26.974 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
5:28.441 default J starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(6), solar_empowerment, starlord, focused_energy(10)
5:29.595 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
5:31.023 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), focused_energy(10)
5:31.976 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), focused_energy(10)
5:32.929 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(7), starlord(2), torrent_of_elements, focused_energy(10)
5:34.051 default O stellar_flare Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
5:35.139 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
5:36.527 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
5:37.452 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, focused_energy(10)
5:38.541 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, focused_energy(10)
5:39.629 default P lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
5:41.018 default Q solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, focused_energy(10)
5:42.108 default Q solar_wrath Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, focused_energy(10)
5:43.198 default I cancel_buff Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
5:43.198 default J starsurge Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(8), lunar_empowerment, torrent_of_elements, focused_energy(10)
5:44.386 default J starsurge Fluffy_Pillow 66.5/100: 67% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, focused_energy(10)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="focusing iris"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

lucid dreams : 43250 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
43250.1 43250.1 25.7 / 0.059% 5305.8 / 12.3% 4444.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
9.7 9.6 Astral Power 0.00% 59.6 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
lucid dreams 43250
Heed My Call 305 (435) 0.7% (1.0%) 8.3 32.70sec 15661 0 Direct 8.3 9230 18459 10968 18.8%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.33 8.33 0.00 0.00 0.0000 0.0000 91315.06 91315.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.76 81.16% 9229.69 8921 10228 9225.51 0 10228 62369 62369 0.00
crit 1.57 18.84% 18458.98 17842 20456 14761.89 0 20456 28947 28947 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 130 0.3% 8.3 32.70sec 4693 0 Direct 8.3 3955 7913 4693 18.6%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.33 8.33 0.00 0.00 0.0000 0.0000 39071.02 39071.02 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.77 81.36% 3955.35 3823 4384 3954.98 3823 4384 26793 26793 0.00
crit 1.55 18.64% 7913.03 7646 8767 6333.54 0 8767 12278 12278 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5868 13.6% 77.0 3.80sec 22844 17528 Direct 77.0 19251 38507 22844 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.00 77.00 0.00 0.00 1.3033 0.0000 1758962.78 1758962.78 0.00 17527.75 17527.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.63 81.34% 19251.17 10135 25236 19259.06 18553 20180 1205732 1205732 0.00
crit 14.37 18.66% 38507.46 20270 50471 38525.82 35514 43620 553231 553231 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2917 6.7% 14.2 21.23sec 61533 60822 Direct 14.2 3289 6573 3898 18.6%  
Periodic 224.6 3069 6134 3643 18.7% 99.2%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.20 14.20 224.61 224.61 1.0117 1.3249 873582.80 873582.80 0.00 2800.51 60821.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.56 81.43% 3288.50 2981 4237 3289.61 3032 3554 38018 38018 0.00
crit 2.64 18.57% 6572.83 5963 8474 6209.36 0 8474 17325 17325 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.6 81.28% 3069.22 2 3945 3070.61 2968 3228 560321 560321 0.00
crit 42.0 18.72% 6134.07 24 7890 6136.39 5603 6654 257918 257918 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 939 2.2% 44.9 6.51sec 6263 0 Direct 44.9 5275 10543 6263 18.8%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.90 44.90 0.00 0.00 0.0000 0.0000 281207.33 281207.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.48 81.25% 5274.98 4769 6778 5277.18 4890 5743 192425 192425 0.00
crit 8.42 18.75% 10543.39 9539 13556 10545.05 0 12475 88782 88782 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3004 (5139) 7.0% (11.9%) 85.1 3.44sec 18084 20508 Direct 85.8 8839 17671 10489 18.7%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.11 85.78 0.00 0.00 0.8818 0.0000 899702.74 899702.74 0.00 20507.62 20507.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.75 81.32% 8838.90 7949 11297 8843.48 8497 9307 616507 616507 0.00
crit 16.03 18.68% 17670.99 15898 22594 17679.75 15994 20034 283195 283195 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2135 4.9% 81.0 3.60sec 7891 0 Direct 81.0 7891 0 7891 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.05 81.05 0.00 0.00 0.0000 0.0000 639517.36 639517.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.05 100.00% 7890.64 5962 16945 7894.29 6889 9217 639517 639517 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6557.86
  • base_dd_max:6557.86
  • base_dd_mult:1.00
 
Starsurge 16350 37.8% 72.8 4.16sec 67229 65405 Direct 72.5 56909 113739 67516 18.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.81 72.50 0.00 0.00 1.0279 0.0000 4894723.61 4894723.61 0.00 65405.13 65405.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.97 81.34% 56909.22 51347 72557 56929.89 54782 60281 3355727 3355727 0.00
crit 13.53 18.66% 113739.34 102695 145115 113777.29 102695 129029 1538997 1538997 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1895 4.4% 12.8 23.57sec 44396 43490 Direct 12.8 2816 5628 3339 18.6%  
Periodic 222.3 1990 3977 2362 18.7% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.79 12.79 222.30 222.30 1.0209 1.3273 567669.25 567669.25 0.00 1842.47 43489.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.41 81.43% 2816.47 2570 3653 2817.42 2586 3084 29325 29325 0.00
crit 2.37 18.57% 5628.37 5140 7306 5208.23 0 7306 13364 13364 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.7 81.28% 1989.63 7 2557 1990.54 1928 2080 359506 359506 0.00
crit 41.6 18.72% 3977.19 83 5114 3978.84 3718 4320 165474 165474 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6470 14.9% 97.8 2.87sec 19709 0 Direct 97.8 16619 33235 19709 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.83 97.83 0.00 0.00 0.0000 0.0000 1928194.81 1928194.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.64 81.40% 16619.39 16021 18369 16618.90 16021 17601 1323562 1323562 0.00
crit 18.19 18.60% 33235.12 32042 36737 33234.04 32042 35849 604633 604633 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3238 7.5% 17.5 17.13sec 55544 54907 Direct 17.5 4568 9136 5419 18.6%  
Periodic 223.8 3295 6586 3911 18.7% 98.9%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.46 17.46 223.82 223.82 1.0116 1.3253 969938.10 969938.10 0.00 3086.02 54907.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.21 81.37% 4567.80 4112 5844 4569.20 4229 4979 64903 64903 0.00
crit 3.25 18.63% 9135.71 8225 11689 8851.94 0 11689 29726 29726 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.9 81.28% 3294.64 2 4237 3296.12 3197 3461 599362 599362 0.00
crit 41.9 18.72% 6585.79 5 8474 6588.51 6163 7174 275948 275948 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
lucid dreams
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.00sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 184.32sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8593 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&!buff.ca_inc.up&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Memory of Lucid Dreams 2.9 123.16sec

Stats details: memory_of_lucid_dreams

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 1.0052 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: memory_of_lucid_dreams

Static Values
  • id:298357
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.sunfire.remains>10&dot.moonfire.remains>10&(astral_power<40|cooldown.ca_inc.remains>30)&dot.stellar_flare.remains>10&!buff.ca_inc.up
Spelldata
  • id:298357
  • name:Memory of Lucid Dreams
  • school:physical
  • tooltip:$?a300120[Shield of the Righteous recharge rate increased by ${{$300120s1=50}*-2}%]?a303412[Frostbolt and Flurry will generate an additional Icicle]?a303399[Fire Blast recharge rate increased by ${{$303399s1=50}*-2}%][{$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation increased by {$s1=100}%].$?$w2>0[ Leech increased by $w2.][]
  • description:Clear your mind and attune yourself with the Heart of Azeroth, $?a137028[increasing your Shield of the Righteous recharge rate by ${{$300120s1=50}*-2}%]?a137020[causing Frostbolt and Flurry to generate an additional Icicle]?a137019[increasing your Fire Blast recharge rate by ${{$303399s1=50}*-2}%][increasing your {$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation rate by {$s1=100}%]$?a298377[ and ][]$?a137020&a298377[increases ][]$?a298377[your Leech by {$298268s6=224}][] for {$d=12 seconds}.
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 8.5 64.0 37.4sec 4.2sec 92.42% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:10.60%
  • arcanic_pulsar_2:12.09%
  • arcanic_pulsar_3:11.97%
  • arcanic_pulsar_4:11.23%
  • arcanic_pulsar_5:10.98%
  • arcanic_pulsar_6:11.57%
  • arcanic_pulsar_7:11.82%
  • arcanic_pulsar_8:12.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 191.1sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.0sec 182.0sec 8.11% 8.10% 0.0(0.0) 2.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.4 0.0 37.1sec 37.1sec 28.43% 35.79% 0.0(0.0) 8.2

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:28.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.9sec 45.5sec 23.73% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.10% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.92%
  • ignition_mages_fuse_2:3.87%
  • ignition_mages_fuse_3:3.82%
  • ignition_mages_fuse_4:3.77%
  • ignition_mages_fuse_5:3.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lucid Dreams 8.4 2.5 34.3sec 25.8sec 25.48% 0.00% 2.5(2.5) 8.1

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_lucid_dreams
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:376.75

Stack Uptimes

  • lucid_dreams_1:25.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298343
  • name:Lucid Dreams
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc298339=When Lucid Dreams $?!a137020[refunds ][]$?a137028[part of a Shield of the Righteous charge]?a137019[part of a charge of Fire Blast]?a137020[generates an icicle][{$@spelldesc298373=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Runes]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]}], gain {$s1=0} Versatility for {$298343d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Lunar Empowerment 16.4 73.6 17.9sec 3.4sec 93.62% 99.99% 10.9(10.9) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:19.97%
  • lunar_empowerment_2:42.83%
  • lunar_empowerment_3:30.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Memory of Lucid Dreams 2.9 0.0 123.1sec 123.1sec 14.23% 16.60% 0.0(0.0) 2.8

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_memory_of_lucid_dreams
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:leech_rating
  • amount:0.00

Stack Uptimes

  • memory_of_lucid_dreams_1:14.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298357
  • name:Memory of Lucid Dreams
  • tooltip:$?a300120[Shield of the Righteous recharge rate increased by ${{$300120s1=50}*-2}%]?a303412[Frostbolt and Flurry will generate an additional Icicle]?a303399[Fire Blast recharge rate increased by ${{$303399s1=50}*-2}%][{$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation increased by {$s1=100}%].$?$w2>0[ Leech increased by $w2.][]
  • description:Clear your mind and attune yourself with the Heart of Azeroth, $?a137028[increasing your Shield of the Righteous recharge rate by ${{$300120s1=50}*-2}%]?a137020[causing Frostbolt and Flurry to generate an additional Icicle]?a137019[increasing your Fire Blast recharge rate by ${{$303399s1=50}*-2}%][increasing your {$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation rate by {$s1=100}%]$?a298377[ and ][]$?a137020&a298377[increases ][]$?a298377[your Leech by {$298268s6=224}][] for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.6 64.5sec 33.5sec 48.23% 0.00% 3.6(49.5) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.59%
  • overwhelming_power_7:1.63%
  • overwhelming_power_8:1.68%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.83%
  • overwhelming_power_12:1.88%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.99%
  • overwhelming_power_15:2.05%
  • overwhelming_power_16:2.11%
  • overwhelming_power_17:2.18%
  • overwhelming_power_18:2.24%
  • overwhelming_power_19:2.31%
  • overwhelming_power_20:2.38%
  • overwhelming_power_21:2.46%
  • overwhelming_power_22:2.53%
  • overwhelming_power_23:2.61%
  • overwhelming_power_24:2.69%
  • overwhelming_power_25:1.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 9.2 79.0 28.0sec 3.4sec 96.55% 94.52% 4.3(4.3) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:13.22%
  • solar_empowerment_2:47.29%
  • solar_empowerment_3:36.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.8 57.0 19.6sec 4.2sec 98.39% 93.19% 25.8(25.8) 7.4

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:15.27%
  • starlord_2:21.36%
  • starlord_3:61.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.8sec 45.4sec 23.79% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.79%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
lucid dreams
starsurge Astral Power 72.8 2912.3 40.0 40.0 1680.7
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 86.11 800.00 (27.79%) 9.29 0.45 0.06%
celestial_alignment Astral Power 2.00 118.22 (4.11%) 59.11 1.77 1.48%
sunfire Astral Power 17.46 59.17 (2.06%) 3.39 0.00 0.00%
shooting_stars Astral Power 44.90 210.15 (7.30%) 4.68 0.27 0.13%
moonfire Astral Power 14.20 47.35 (1.64%) 3.34 0.00 0.00%
stellar_flare Astral Power 12.79 113.39 (3.94%) 8.87 0.04 0.04%
lunar_strike Astral Power 77.00 1020.88 (35.46%) 13.26 6.71 0.65%
lucid_dreams Astral Power 10.94 218.78 (7.60%) 20.00 0.00 0.00%
natures_balance Astral Power 400.36 200.01 (6.95%) 0.50 0.17 0.08%
arcanic_pulsar Astral Power 7.58 91.00 (3.16%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 9.60 9.71
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 24.38 0.00 88.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.1%

Statistics & Data Analysis

Fight Length
Sample Data lucid dreams Fight Length
Count 11043
Mean 299.90
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data lucid dreams Damage Per Second
Count 11043
Mean 43250.14
Minimum 38844.98
Maximum 49009.63
Spread ( max - min ) 10164.65
Range [ ( max - min ) / 2 * 100% ] 11.75%
Standard Deviation 1377.7433
5th Percentile 41062.37
95th Percentile 45573.64
( 95th Percentile - 5th Percentile ) 4511.27
Mean Distribution
Standard Deviation 13.1107
95.00% Confidence Intervall ( 43224.44 - 43275.83 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3899
0.1 Scale Factor Error with Delta=300 16204
0.05 Scale Factor Error with Delta=300 64816
0.01 Scale Factor Error with Delta=300 1620393
Priority Target DPS
Sample Data lucid dreams Priority Target Damage Per Second
Count 11043
Mean 43250.14
Minimum 38844.98
Maximum 49009.63
Spread ( max - min ) 10164.65
Range [ ( max - min ) / 2 * 100% ] 11.75%
Standard Deviation 1377.7433
5th Percentile 41062.37
95th Percentile 45573.64
( 95th Percentile - 5th Percentile ) 4511.27
Mean Distribution
Standard Deviation 13.1107
95.00% Confidence Intervall ( 43224.44 - 43275.83 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3899
0.1 Scale Factor Error with Delta=300 16204
0.05 Scale Factor Error with Delta=300 64816
0.01 Scale Factor Error with Delta=300 1620393
DPS(e)
Sample Data lucid dreams Damage Per Second (Effective)
Count 11043
Mean 43250.14
Minimum 38844.98
Maximum 49009.63
Spread ( max - min ) 10164.65
Range [ ( max - min ) / 2 * 100% ] 11.75%
Damage
Sample Data lucid dreams Damage
Count 11043
Mean 12943884.88
Minimum 10027048.34
Maximum 15916627.10
Spread ( max - min ) 5889578.76
Range [ ( max - min ) / 2 * 100% ] 22.75%
DTPS
Sample Data lucid dreams Damage Taken Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data lucid dreams Healing Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data lucid dreams Healing Per Second (Effective)
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data lucid dreams Heal
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data lucid dreams Healing Taken Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data lucid dreams Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data lucid dreamsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data lucid dreams Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
H 2.87 memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(astral_power<40|cooldown.ca_inc.remains>30)&dot.stellar_flare.remains>10&!buff.ca_inc.up
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&!buff.ca_inc.up
I 2.00 celestial_alignment,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&!buff.ca_inc.up&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 7.42 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 72.81 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.10 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.49 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.01 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.70 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.79 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 77.18 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 85.35 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.36 sunfire

Sample Sequence

0123456789ACDKONPKHIFGKRQKRQKRQKRNKORQJKRQPRKRKRQKRQKRQKQNQQRJKQORKRQKRPQKRQNQRQRKRKRQKMRQQKNPRQRQRKQKROQQNRKRQPRQRJKRKRQKRQRKRLOQQQRRKPQKNQQGKOHRRKQKRQJKRQKNPKRQRKRQKOQQQRRKKNQKRQKPRQKORQQRJKKNRQKRMQKRQIEFKPRQRNJKRKRQKRQRQKRQRKOQQNPRKRKRQRKQQRKOQKNQQRPKQRKQKRQGQNKOHRQRRJKRKRKPRLQKQKQQQORRQRKKQNRKPRQKRQQROQRJKRKRKRLQQKQPRQRRROKKNQQRKQRRKQRPRNRRKKRKRQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask lucid dreams 58.0/100: 58% astral_power
Pre precombat 1 food lucid dreams 58.0/100: 58% astral_power
Pre precombat 2 augmentation lucid dreams 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.239 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.166 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.093 default P stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.019 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.943 default H memory_of_lucid_dreams Fluffy_Pillow 3.0/100: 3% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:05.843 default I celestial_alignment Fluffy_Pillow 3.5/100: 4% astral_power bloodlust, memory_of_lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:06.627 default F berserking Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, memory_of_lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:06.627 default G use_items Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:06.627 default K starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.381 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.136 default Q lunar_strike Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.981 default K starsurge Fluffy_Pillow 85.5/100: 86% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.736 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.489 default Q lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.332 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.086 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.840 default Q lunar_strike Fluffy_Pillow 72.5/100: 73% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.651 default K starsurge Fluffy_Pillow 97.0/100: 97% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.406 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.160 default N sunfire Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.915 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.668 default O moonfire Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.421 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.175 default Q lunar_strike Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.952 default J cancel_buff Fluffy_Pillow 96.5/100: 97% astral_power bloodlust, memory_of_lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.952 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power bloodlust, memory_of_lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.707 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, memory_of_lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.461 default Q lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.332 default P stellar_flare Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.086 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.839 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.592 default R solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, lucid_dreams, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), ignition_mages_fuse(5)
0:24.346 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, lucid_dreams, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), ignition_mages_fuse(5)
0:25.101 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
0:25.854 default Q lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(25), ignition_mages_fuse(5)
0:26.607 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power bloodlust, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), ignition_mages_fuse(5)
0:27.363 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23)
0:28.118 default Q lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22)
0:29.014 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(21)
0:29.769 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(21)
0:30.524 default Q lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(20)
0:31.426 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(25)
0:32.179 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(24)
0:33.201 default N sunfire Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23)
0:34.006 default Q lunar_strike Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22)
0:35.036 default Q lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21)
0:36.071 default R solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(20)
0:36.826 default J cancel_buff Fluffy_Pillow 95.5/100: 96% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(20)
0:36.826 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment, solar_empowerment, overwhelming_power(20)
0:37.715 default Q lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(19)
0:38.816 default O moonfire Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, lucid_dreams, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(18), conch_of_dark_whispers
0:39.683 default R solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(17), conch_of_dark_whispers
0:40.437 default K starsurge Fluffy_Pillow 80.5/100: 81% astral_power bloodlust, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(16), conch_of_dark_whispers
0:41.311 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(15), conch_of_dark_whispers
0:42.252 default Q lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(14), conch_of_dark_whispers
0:43.665 default K starsurge Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(13), conch_of_dark_whispers
0:44.780 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(12), conch_of_dark_whispers
0:45.705 default P stellar_flare Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers
0:46.798 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(10), conch_of_dark_whispers
0:48.193 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8), conch_of_dark_whispers
0:49.298 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(7), conch_of_dark_whispers
0:50.239 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(6), conch_of_dark_whispers
0:51.655 default N sunfire Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(5), conch_of_dark_whispers
0:52.770 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(4), conch_of_dark_whispers
0:54.195 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), overwhelming_power(2)
0:55.156 default Q lunar_strike Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power
0:56.599 default R solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements
0:57.567 default K starsurge Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(8), solar_empowerment, torrent_of_elements
0:58.805 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements
0:59.694 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
1:00.741 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
1:01.603 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements
1:02.898 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
1:03.915 default M moonfire Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
1:04.902 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
1:05.868 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
1:07.315 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
1:08.760 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
1:09.897 default N sunfire Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:11.033 default P stellar_flare Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:12.170 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:13.139 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:14.588 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3)
1:15.554 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
1:17.002 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3)
1:17.968 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment
1:19.207 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord
1:20.738 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord
1:21.941 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2)
1:22.935 default O moonfire Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:24.105 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:25.593 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2)
1:27.081 default N sunfire Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2)
1:28.247 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2)
1:29.241 default K starsurge Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2)
1:30.410 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3)
1:31.375 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:32.823 default P stellar_flare Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3)
1:33.959 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3)
1:34.924 default Q lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
1:36.371 default R solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3)
1:37.338 default J cancel_buff Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
1:37.338 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(6), solar_empowerment(2)
1:38.577 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord
1:39.597 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord
1:40.799 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2)
1:41.791 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:43.279 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2)
1:44.448 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:45.287 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3)
1:46.545 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:47.385 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
1:48.374 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3)
1:49.214 default L sunfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
1:50.202 default O moonfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3)
1:51.339 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3)
1:52.786 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3)
1:54.235 default Q lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3)
1:55.682 default R solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar, solar_empowerment, starlord(3)
1:56.650 default R solar_wrath Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar, lunar_empowerment, starlord(3)
1:57.787 default K starsurge Fluffy_Pillow 97.5/100: 98% astral_power arcanic_pulsar, lunar_empowerment(2)
1:59.025 default P stellar_flare Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord
2:00.228 default Q lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord
2:01.760 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord
2:02.961 default N sunfire Fluffy_Pillow 60.5/100: 61% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2)
2:04.128 default Q lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2)
2:05.617 default Q lunar_strike Fluffy_Pillow 77.5/100: 78% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:07.106 default G use_items Fluffy_Pillow 90.5/100: 91% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25)
2:07.106 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25), ignition_mages_fuse
2:08.133 default O moonfire Fluffy_Pillow 51.0/100: 51% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24), ignition_mages_fuse
2:09.136 default H memory_of_lucid_dreams Fluffy_Pillow 55.0/100: 55% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(23), ignition_mages_fuse
2:10.143 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power memory_of_lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(22), ignition_mages_fuse
2:11.002 default R solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power memory_of_lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), ignition_mages_fuse
2:11.863 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power memory_of_lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(21), ignition_mages_fuse(2)
2:12.837 default Q lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(20), ignition_mages_fuse(2)
2:14.082 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), ignition_mages_fuse(2)
2:15.066 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(17), conch_of_dark_whispers, ignition_mages_fuse(2)
2:15.905 default Q lunar_strike Fluffy_Pillow 71.5/100: 72% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.115 default J cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(15), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.115 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), overwhelming_power(15), conch_of_dark_whispers, ignition_mages_fuse(3)
2:18.158 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(3), starlord, overwhelming_power(14), conch_of_dark_whispers, ignition_mages_fuse(3)
2:19.022 default Q lunar_strike Fluffy_Pillow 77.5/100: 78% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord, overwhelming_power(13), conch_of_dark_whispers, ignition_mages_fuse(3)
2:20.316 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(12), conch_of_dark_whispers, ignition_mages_fuse(4)
2:21.301 default N sunfire Fluffy_Pillow 60.5/100: 61% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(3), starlord(2), overwhelming_power(11), conch_of_dark_whispers, ignition_mages_fuse(4)
2:22.261 default P stellar_flare Fluffy_Pillow 67.0/100: 67% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(3), starlord(2), overwhelming_power(10), conch_of_dark_whispers, ignition_mages_fuse(4)
2:23.224 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(3), starlord(2), overwhelming_power(9), conch_of_dark_whispers, ignition_mages_fuse(5)
2:24.154 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(8), conch_of_dark_whispers, ignition_mages_fuse(5)
2:24.908 default Q lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(8), conch_of_dark_whispers, ignition_mages_fuse(5)
2:25.917 default R solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(7), conch_of_dark_whispers, ignition_mages_fuse(5)
2:26.673 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(6), conch_of_dark_whispers, ignition_mages_fuse(5)
2:27.468 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(5), conch_of_dark_whispers
2:28.294 default Q lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(4), conch_of_dark_whispers
2:29.536 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(3), conch_of_dark_whispers
2:30.514 default O moonfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(2)
2:31.643 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power
2:33.085 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3)
2:34.533 default Q lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25)
2:35.856 default R solar_wrath Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(24)
2:36.742 default R solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(23)
2:37.631 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(2), torrent_of_elements, overwhelming_power(22)
2:38.777 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(21)
2:39.891 default N sunfire Fluffy_Pillow 58.0/100: 58% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(20)
2:40.978 default Q lunar_strike Fluffy_Pillow 61.5/100: 62% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19)
2:42.367 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(17)
2:43.465 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(16)
2:44.377 default Q lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15)
2:45.749 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14)
2:46.828 default P stellar_flare Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(13)
2:47.910 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(12)
2:48.834 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(11)
2:50.222 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24)
2:51.265 default O moonfire Fluffy_Pillow 36.5/100: 37% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(23)
2:52.310 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(22)
2:53.203 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21)
2:54.542 default Q lunar_strike Fluffy_Pillow 61.5/100: 62% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20)
2:55.888 default R solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power lucid_dreams, arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(19)
2:56.790 default J cancel_buff Fluffy_Pillow 91.0/100: 91% astral_power lucid_dreams, arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(18)
2:56.790 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power lucid_dreams, arcanic_pulsar(7), solar_empowerment, overwhelming_power(18)
2:57.952 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(17)
2:59.083 default N sunfire Fluffy_Pillow 44.5/100: 45% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(15)
3:00.046 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(14)
3:00.870 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(14)
3:02.100 default K starsurge Fluffy_Pillow 69.5/100: 70% astral_power lucid_dreams, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(12)
3:03.073 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(11)
3:03.881 default M moonfire Fluffy_Pillow 39.0/100: 39% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11)
3:04.830 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power lucid_dreams, arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(10)
3:06.227 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8)
3:07.331 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(7)
3:08.273 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(6)
3:09.688 default I celestial_alignment Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(5)
3:10.658 default E potion Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(4)
3:10.658 default F berserking Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(4), battle_potion_of_intellect
3:10.658 default K starsurge Fluffy_Pillow 82.5/100: 83% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(4), battle_potion_of_intellect
3:11.545 default P stellar_flare Fluffy_Pillow 47.0/100: 47% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(3), battle_potion_of_intellect
3:12.435 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(2), battle_potion_of_intellect
3:13.194 default Q lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power, battle_potion_of_intellect
3:14.336 default R solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:15.100 default N sunfire Fluffy_Pillow 85.5/100: 86% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), battle_potion_of_intellect
3:16.000 default J cancel_buff Fluffy_Pillow 89.0/100: 89% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24), battle_potion_of_intellect
3:16.000 default K starsurge Fluffy_Pillow 89.0/100: 89% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, overwhelming_power(24), battle_potion_of_intellect
3:16.898 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(24), battle_potion_of_intellect
3:17.652 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(23), battle_potion_of_intellect
3:18.529 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(22), battle_potion_of_intellect
3:19.283 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(21), battle_potion_of_intellect
3:20.376 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(20), battle_potion_of_intellect
3:21.235 default R solar_wrath Fluffy_Pillow 0.5/100: 1% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(19), battle_potion_of_intellect
3:21.990 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(19), battle_potion_of_intellect
3:23.060 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(17), battle_potion_of_intellect
3:23.851 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(17), battle_potion_of_intellect
3:25.034 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(15), conch_of_dark_whispers, battle_potion_of_intellect
3:25.969 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(15), conch_of_dark_whispers, battle_potion_of_intellect
3:26.768 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(14), conch_of_dark_whispers, battle_potion_of_intellect
3:27.964 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(13), conch_of_dark_whispers, battle_potion_of_intellect
3:28.906 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(12), conch_of_dark_whispers, battle_potion_of_intellect
3:29.851 default O moonfire Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(11), conch_of_dark_whispers, battle_potion_of_intellect
3:30.942 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(10), conch_of_dark_whispers, battle_potion_of_intellect
3:32.337 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(8), conch_of_dark_whispers, battle_potion_of_intellect
3:33.742 default N sunfire Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(7), conch_of_dark_whispers, battle_potion_of_intellect
3:34.850 default P stellar_flare Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(6), conch_of_dark_whispers, battle_potion_of_intellect
3:35.962 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(5), conch_of_dark_whispers
3:36.910 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(8), overwhelming_power(4), conch_of_dark_whispers
3:38.132 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(2), conch_of_dark_whispers
3:39.015 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power, conch_of_dark_whispers
3:40.058 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
3:40.922 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2)
3:42.216 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2)
3:43.081 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(25)
3:44.010 default Q lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24)
3:45.337 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers
3:46.669 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers
3:47.562 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
3:48.616 default O moonfire Fluffy_Pillow 24.5/100: 25% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers
3:49.673 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers
3:51.025 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers
3:52.092 default N sunfire Fluffy_Pillow 2.0/100: 2% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers
3:53.166 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15), conch_of_dark_whispers
3:54.538 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers
3:55.913 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13), conch_of_dark_whispers
3:56.835 default P stellar_flare Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(12), conch_of_dark_whispers
3:57.922 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(4), solar_empowerment, torrent_of_elements, overwhelming_power(11), conch_of_dark_whispers
3:59.111 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(9), conch_of_dark_whispers
4:00.592 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(8), conch_of_dark_whispers
4:01.584 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(7), conch_of_dark_whispers
4:02.754 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(6), conch_of_dark_whispers
4:04.211 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(4), conch_of_dark_whispers
4:05.361 default R solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(3), conch_of_dark_whispers
4:06.316 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2), conch_of_dark_whispers
4:07.753 default G use_items Fluffy_Pillow 23.5/100: 24% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power, conch_of_dark_whispers
4:07.753 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power, conch_of_dark_whispers, ignition_mages_fuse
4:09.136 default N sunfire Fluffy_Pillow 36.5/100: 37% astral_power lucid_dreams, arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse
4:10.224 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse
4:11.313 default O moonfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse
4:12.403 default H memory_of_lucid_dreams Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse(2)
4:13.447 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse(2)
4:14.335 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(2)
4:15.666 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(2)
4:16.554 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(3)
4:17.407 default J cancel_buff Fluffy_Pillow 84.0/100: 84% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), starlord(3), torrent_of_elements, ignition_mages_fuse(3)
4:17.407 default K starsurge Fluffy_Pillow 84.0/100: 84% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), torrent_of_elements, ignition_mages_fuse(3)
4:18.500 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power memory_of_lucid_dreams, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, ignition_mages_fuse(3)
4:19.284 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power memory_of_lucid_dreams, celestial_alignment, lunar_empowerment, starlord, ignition_mages_fuse(3)
4:20.206 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power memory_of_lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), ignition_mages_fuse(4)
4:20.961 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power memory_of_lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), ignition_mages_fuse(4)
4:21.826 default P stellar_flare Fluffy_Pillow 11.0/100: 11% astral_power memory_of_lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), ignition_mages_fuse(4)
4:22.667 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power memory_of_lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), ignition_mages_fuse(4)
4:23.421 default L sunfire Fluffy_Pillow 44.0/100: 44% astral_power memory_of_lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), ignition_mages_fuse(4)
4:24.261 default Q lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power memory_of_lucid_dreams, arcanic_pulsar(2), lunar_empowerment(3), starlord(3), ignition_mages_fuse(5)
4:25.448 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power memory_of_lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), starlord(3), ignition_mages_fuse(5)
4:26.380 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power memory_of_lucid_dreams, arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), ignition_mages_fuse(5)
4:27.563 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), ignition_mages_fuse(5)
4:28.495 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3)
4:29.943 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
4:31.390 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24)
4:32.718 default O moonfire Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(23)
4:33.762 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(22)
4:34.655 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(21)
4:35.549 default Q lunar_strike Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(4), lunar_empowerment, starlord(3), overwhelming_power(20)
4:36.897 default R solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(19)
4:37.959 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(4), overwhelming_power(18)
4:39.119 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(16)
4:40.253 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(15)
4:41.661 default N sunfire Fluffy_Pillow 49.0/100: 49% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(14)
4:42.770 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(13)
4:43.718 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(12)
4:44.835 default P stellar_flare Fluffy_Pillow 22.0/100: 22% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(11)
4:45.927 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(10)
4:46.860 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(9)
4:48.260 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7)
4:49.369 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(6)
4:50.313 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(5)
4:51.733 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(4)
4:53.159 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), overwhelming_power(2)
4:54.120 default O moonfire Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power
4:55.253 default Q lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
4:56.699 default R solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3)
4:57.666 default J cancel_buff Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3)
4:57.666 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(8), solar_empowerment
4:58.904 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord
4:59.794 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord
5:00.841 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2)
5:01.705 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
5:02.722 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3)
5:03.562 default L sunfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
5:04.551 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3)
5:06.000 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3)
5:07.448 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3)
5:08.584 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
5:10.032 default P stellar_flare Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
5:11.167 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
5:12.134 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
5:13.581 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
5:14.548 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
5:15.515 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
5:16.651 default O moonfire Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
5:17.787 default K starsurge Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(3), torrent_of_elements, conch_of_dark_whispers
5:19.027 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
5:20.228 default N sunfire Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
5:21.397 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
5:22.884 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
5:24.372 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
5:25.366 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers
5:26.536 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
5:27.984 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
5:28.951 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
5:29.917 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, conch_of_dark_whispers
5:31.054 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
5:32.501 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power lucid_dreams, arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(25), conch_of_dark_whispers
5:33.387 default P stellar_flare Fluffy_Pillow 42.5/100: 43% astral_power lucid_dreams, arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(24)
5:34.429 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power lucid_dreams, arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(23)
5:35.475 default N sunfire Fluffy_Pillow 60.0/100: 60% astral_power lucid_dreams, arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(22)
5:36.526 default R solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power lucid_dreams, arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(21)
5:37.579 default R solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power lucid_dreams, arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(20)
5:38.637 default K starsurge Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(7), torrent_of_elements, overwhelming_power(19)
5:39.795 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(18)
5:40.922 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(17)
5:41.734 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(16)
5:42.695 default R solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15)
5:43.491 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(14)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="lucid dreams"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(astral_power<40|cooldown.ca_inc.remains>30)&dot.stellar_flare.remains>10&!buff.ca_inc.up
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&!buff.ca_inc.up
actions+=/celestial_alignment,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&!buff.ca_inc.up&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

purification protocol : 41043 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
41042.7 41042.7 23.2 / 0.057% 4822.7 / 11.8% 5038.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 8.0 Astral Power 0.00% 58.4 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
purification protocol 41043
Heed My Call 298 (426) 0.7% (1.0%) 8.2 33.00sec 15487 0 Direct 8.2 9128 18265 10837 18.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.25 8.25 0.00 0.00 0.0000 0.0000 89388.83 89388.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.71 81.29% 9127.94 8921 9813 9123.28 0 9813 61204 61204 0.00
crit 1.54 18.71% 18264.79 17842 19626 14482.16 0 19626 28185 28185 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 128 0.3% 8.2 33.00sec 4649 0 Direct 8.2 3912 7829 4649 18.8%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.25 8.25 0.00 0.00 0.0000 0.0000 38348.31 38348.31 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.70 81.17% 3911.79 3823 4206 3910.52 0 4206 26191 26191 0.00
crit 1.55 18.83% 7829.37 7646 8411 6253.03 0 8411 12157 12157 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5798 14.1% 76.8 3.81sec 22627 17435 Direct 76.8 19057 38085 22627 18.8%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.77 76.77 0.00 0.00 1.2978 0.0000 1736984.19 1736984.19 0.00 17435.40 17435.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.36 81.24% 19057.02 10135 24211 19064.90 18417 20140 1188461 1188461 0.00
crit 14.40 18.76% 38084.52 20270 48422 38102.14 34659 43490 548523 548523 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2851 7.0% 14.0 21.36sec 60809 60148 Direct 14.0 3281 6550 3889 18.6%  
Periodic 222.9 3021 6037 3585 18.7% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.04 14.04 222.94 222.94 1.0111 1.3310 853914.68 853914.68 0.00 2746.26 60147.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.43 81.40% 3281.40 2981 4065 3283.67 3043 3637 37506 37506 0.00
crit 2.61 18.60% 6550.28 5963 8130 6180.87 0 8130 17113 17113 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.3 81.30% 3021.49 2 3785 3022.81 2934 3155 547673 547673 0.00
crit 41.7 18.70% 6037.08 5 7570 6039.85 5625 6533 251623 251623 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Purification Protocol 742 1.8% 16.7 17.30sec 13333 0 Direct 16.7 11227 22450 13333 18.8%  

Stats details: purification_protocol

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.69 16.69 0.00 0.00 0.0000 0.0000 222502.56 222502.56 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.56 81.24% 11227.12 10972 12069 11226.54 10972 11913 152204 152204 0.00
crit 3.13 18.76% 22450.17 21944 24139 21480.57 0 24139 70299 70299 0.00
 
 

Action details: purification_protocol

Static Values
  • id:295293
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295293
  • name:Purification Protocol
  • school:physical
  • tooltip:
  • description:MOTHER has added a Purification Protocol to your Heart of Azeroth, allowing your damaging spells and abilities to release a blast of Azerite energy at your target, dealing ${{$s1=1920}*(1+$@versadmg)} Fire damage to any enemy within $295305A2 yds$?a295363[, and heals you for ${{$295293s4=869}*(1+$@versadmg)} every $295310t1 sec for {$295310d=8 seconds}][]. Purification Protocol deals {$s2=50}% additional damage against Aberrations.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9969.52
  • base_dd_max:9969.52
  • base_dd_mult:1.00
 
Purifying Blast 0 (823) 0.0% (2.0%) 5.5 60.37sec 44980 39421

Stats details: purifying_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 0.00 0.00 0.00 1.1412 0.0000 0.00 0.00 0.00 39420.71 39420.71
 
 

Action details: purifying_blast

Static Values
  • id:295337
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295337
  • name:Purifying Blast
  • school:physical
  • tooltip:
  • description:Call down a purifying beam upon the target area, dealing ${{$295293s3=1173}*(1+$@versadmg)*{$s2=7}} Fire damage over {$d=6 seconds}.$?a295364[ Has a low chance to immediately annihilate any specimen deemed unworthy by MOTHER.][]$?a295352[ When an enemy dies within the beam, your damage is increased by {$295354s1=10}% for {$295354d=8 seconds}.][] Any Aberration struck by the beam is stunned for {$295366d=3 seconds}.
 
    Purification Protocol (purifying_tick) 823 2.0% 38.0 7.63sec 6484 0 Periodic 38.0 5476 10955 6484 18.4% 0.0%

Stats details: purifying_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.97 0.00 0.00 37.97 0.0000 0.0000 246182.31 246182.31 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.0 81.60% 5475.78 5364 5900 5475.57 5364 5817 169653 169653 0.00
crit 7.0 18.40% 10955.45 10728 11801 10945.89 0 11801 76529 76529 0.00
 
 

Action details: purifying_tick

Static Values
  • id:295293
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295293
  • name:Purification Protocol
  • school:physical
  • tooltip:
  • description:MOTHER has added a Purification Protocol to your Heart of Azeroth, allowing your damaging spells and abilities to release a blast of Azerite energy at your target, dealing ${{$s1=1920}*(1+$@versadmg)} Fire damage to any enemy within $295305A2 yds$?a295363[, and heals you for ${{$295293s4=869}*(1+$@versadmg)} every $295310t1 sec for {$295310d=8 seconds}][]. Purification Protocol deals {$s2=50}% additional damage against Aberrations.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4873.57
  • base_dd_max:4873.57
  • base_dd_mult:1.00
 
Shooting Stars 918 2.2% 44.6 6.52sec 6167 0 Direct 44.6 5194 10385 6167 18.7%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.61 44.61 0.00 0.00 0.0000 0.0000 275084.79 275084.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.24 81.25% 5193.76 4769 6503 5195.78 4905 5635 188234 188234 0.00
crit 8.36 18.75% 10384.87 9539 13006 10387.99 0 13006 86851 86851 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3201 (5117) 7.8% (12.5%) 92.4 3.18sec 16585 18517 Direct 92.9 8698 17385 10319 18.7%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.43 92.94 0.00 0.00 0.8957 0.0000 959042.52 959042.52 0.00 18517.04 18517.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.59 81.34% 8697.93 7949 10838 8703.01 8421 9210 657491 657491 0.00
crit 17.35 18.66% 17384.84 15898 21676 17393.81 15898 20071 301552 301552 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1915 4.7% 73.9 3.96sec 7763 0 Direct 73.9 7763 0 7763 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.92 73.92 0.00 0.00 0.0000 0.0000 573834.67 573834.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.92 100.00% 7762.92 5962 16257 7766.49 6760 9131 573835 573835 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starsurge 13484 32.9% 60.9 4.94sec 66246 63551 Direct 60.8 55989 111914 66457 18.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.95 60.76 0.00 0.00 1.0424 0.0000 4037650.46 4037650.46 0.00 63551.02 63551.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.38 81.28% 55988.91 51347 69612 56013.06 54158 58746 2765006 2765006 0.00
crit 11.37 18.72% 111913.92 102695 139223 111956.47 102695 132182 1272644 1272644 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1849 4.5% 12.8 23.57sec 43447 42377 Direct 12.8 2764 5522 3279 18.7%  
Periodic 220.4 1958 3912 2323 18.7% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.75 12.75 220.45 220.45 1.0253 1.3346 553949.58 553949.58 0.00 1802.73 42376.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.37 81.34% 2764.32 2570 3504 2765.16 2592 3036 28667 28667 0.00
crit 2.38 18.66% 5522.00 5140 7009 5102.78 0 7009 13141 13141 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.3 81.31% 1957.97 4 2453 1958.84 1905 2044 350977 350977 0.00
crit 41.2 18.69% 3912.47 28 4906 3914.18 3647 4227 161165 161165 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5857 14.2% 89.8 3.08sec 19438 0 Direct 89.8 16384 32774 19438 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.75 89.75 0.00 0.00 0.0000 0.0000 1744644.55 1744644.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.03 81.37% 16384.04 16021 17623 16383.73 16021 17262 1196522 1196522 0.00
crit 16.72 18.63% 32773.70 32042 35246 32771.27 32042 34999 548122 548122 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3177 7.7% 18.0 16.50sec 52764 51880 Direct 18.0 4503 9009 5349 18.8%  
Periodic 222.1 3245 6484 3851 18.7% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.04 18.04 222.06 222.06 1.0171 1.3323 951638.55 951638.55 0.00 3028.82 51880.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.65 81.22% 4503.24 4112 5607 4504.06 4200 4841 65966 65966 0.00
crit 3.39 18.78% 9009.04 8225 11214 8787.43 0 11214 30515 30515 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.5 81.30% 3245.31 4 4065 3246.75 3156 3386 585884 585884 0.00
crit 41.5 18.70% 6483.90 5 8130 6486.36 6072 7159 269273 269273 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
purification protocol
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.60sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.68sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9027 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.2 53.6 44.3sec 4.9sec 92.80% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.53%
  • arcanic_pulsar_2:10.38%
  • arcanic_pulsar_3:11.00%
  • arcanic_pulsar_4:10.71%
  • arcanic_pulsar_5:13.80%
  • arcanic_pulsar_6:10.61%
  • arcanic_pulsar_7:10.78%
  • arcanic_pulsar_8:14.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 188.6sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.6sec 182.6sec 8.11% 7.64% 0.0(0.0) 2.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.5sec 37.5sec 25.84% 32.61% 0.0(0.0) 8.1

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.1sec 45.4sec 23.65% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.3sec 120.3sec 19.16% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.88%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.1 45.5 8.9sec 3.8sec 81.74% 99.69% 1.9(1.9) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.39%
  • lunar_empowerment_2:31.47%
  • lunar_empowerment_3:13.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.5 64.3sec 33.7sec 47.99% 0.00% 3.5(48.6) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.98%
  • overwhelming_power_15:2.04%
  • overwhelming_power_16:2.10%
  • overwhelming_power_17:2.17%
  • overwhelming_power_18:2.23%
  • overwhelming_power_19:2.30%
  • overwhelming_power_20:2.36%
  • overwhelming_power_21:2.44%
  • overwhelming_power_22:2.51%
  • overwhelming_power_23:2.59%
  • overwhelming_power_24:2.66%
  • overwhelming_power_25:1.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 24.6 51.7 12.0sec 3.9sec 85.45% 79.65% 0.2(0.2) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.11%
  • solar_empowerment_2:39.47%
  • solar_empowerment_3:17.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.8 20.3sec 4.9sec 97.06% 92.08% 15.8(15.8) 11.3

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.81%
  • starlord_2:22.30%
  • starlord_3:59.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.9sec 45.5sec 23.66% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.66%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
purification protocol
starsurge Astral Power 60.9 2438.0 40.0 40.0 1656.1
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 93.43 747.35 (31.14%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.33%) 40.00 0.00 0.00%
sunfire Astral Power 18.04 54.11 (2.25%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.60 178.41 (7.43%) 4.00 0.01 0.00%
moonfire Astral Power 14.04 42.13 (1.76%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.75 102.00 (4.25%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.77 921.15 (38.38%) 12.00 0.06 0.01%
natures_balance Astral Power 400.36 200.18 (8.34%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.25 75.00 (3.12%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.00 8.13
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.03 0.00 78.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data purification protocol Fight Length
Count 11043
Mean 299.90
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data purification protocol Damage Per Second
Count 11043
Mean 41042.69
Minimum 36941.81
Maximum 45597.52
Spread ( max - min ) 8655.72
Range [ ( max - min ) / 2 * 100% ] 10.54%
Standard Deviation 1244.0938
5th Percentile 39080.71
95th Percentile 43137.04
( 95th Percentile - 5th Percentile ) 4056.33
Mean Distribution
Standard Deviation 11.8389
95.00% Confidence Intervall ( 41019.48 - 41065.89 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3530
0.1 Scale Factor Error with Delta=300 13213
0.05 Scale Factor Error with Delta=300 52851
0.01 Scale Factor Error with Delta=300 1321265
Priority Target DPS
Sample Data purification protocol Priority Target Damage Per Second
Count 11043
Mean 41042.69
Minimum 36941.81
Maximum 45597.52
Spread ( max - min ) 8655.72
Range [ ( max - min ) / 2 * 100% ] 10.54%
Standard Deviation 1244.0938
5th Percentile 39080.71
95th Percentile 43137.04
( 95th Percentile - 5th Percentile ) 4056.33
Mean Distribution
Standard Deviation 11.8389
95.00% Confidence Intervall ( 41019.48 - 41065.89 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3530
0.1 Scale Factor Error with Delta=300 13213
0.05 Scale Factor Error with Delta=300 52851
0.01 Scale Factor Error with Delta=300 1321265
DPS(e)
Sample Data purification protocol Damage Per Second (Effective)
Count 11043
Mean 41042.69
Minimum 36941.81
Maximum 45597.52
Spread ( max - min ) 8655.72
Range [ ( max - min ) / 2 * 100% ] 10.54%
Damage
Sample Data purification protocol Damage
Count 11043
Mean 12283166.00
Minimum 9508950.81
Maximum 15316128.06
Spread ( max - min ) 5807177.25
Range [ ( max - min ) / 2 * 100% ] 23.64%
DTPS
Sample Data purification protocol Damage Taken Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data purification protocol Healing Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data purification protocol Healing Per Second (Effective)
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data purification protocol Heal
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data purification protocol Healing Taken Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data purification protocol Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data purification protocolTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data purification protocol Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
H 5.47 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.94 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.95 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.00 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.79 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.59 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.26 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.75 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 77.13 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 92.68 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.45 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRKRQRQKRQKRQRNRORQRQKPRQKQRQKRQQKRKRQRKRLQOQKRKRPQQKRNQQKRQRHRKOQRKQRNPRKRQRQMRRKKQQNRKQRPRKQQRROKQNRKQQRKQRRPRHQRKKGNORKRQLQKQQRQRRRQJKKPQKORNQQKRQRRRRRKQKPNOQRKRQRKRLQHQKRQIEFKRKOPRQKRQNRQRQRJKRKRQKQQRORNPQRRJKRQKRQKQKQQNOQRPRRHKKQGQKRQNQKROQQRRRPKKRQRQKRLQKQRQKORQQKRQNPKRQRRKQQRROHRKNKQQPKRQKRQLRRRORKQKQRRRKPQNRKQRRR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask purification protocol 58.0/100: 58% astral_power
Pre precombat 1 food purification protocol 58.0/100: 58% astral_power
Pre precombat 2 augmentation purification protocol 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H purifying_blast Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.238 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, battle_potion_of_intellect
0:02.191 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.118 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.044 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.970 default I celestial_alignment Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.775 default F berserking Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.775 default G use_items Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.775 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:06.530 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.284 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.038 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.792 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.638 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.392 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.146 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.900 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.653 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.407 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.163 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.918 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.675 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.433 default N sunfire Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.186 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.940 default O moonfire Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.694 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.450 default Q lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(16), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.234 default R solar_wrath Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(15), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.989 default Q lunar_strike Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(15), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.776 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), overwhelming_power(14), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.531 default P stellar_flare Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(13), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.288 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(12), ignition_mages_fuse(5)
0:24.042 default Q lunar_strike Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord, overwhelming_power(11), ignition_mages_fuse(5)
0:24.855 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(11), ignition_mages_fuse(5)
0:25.612 default Q lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(10), ignition_mages_fuse(5)
0:26.522 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(9)
0:27.277 default Q lunar_strike Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(8), conch_of_dark_whispers
0:28.388 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24), conch_of_dark_whispers
0:29.214 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(23), conch_of_dark_whispers
0:29.968 default Q lunar_strike Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers
0:30.993 default Q lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers
0:32.023 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(20), conch_of_dark_whispers
0:32.839 default R solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(20), conch_of_dark_whispers
0:33.593 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers
0:34.349 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(23), conch_of_dark_whispers
0:35.105 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers
0:36.000 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(21), conch_of_dark_whispers
0:36.753 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), conch_of_dark_whispers
0:37.507 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20), conch_of_dark_whispers
0:38.263 default L sunfire Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers
0:39.018 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), conch_of_dark_whispers
0:40.064 default O moonfire Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers
0:40.887 default Q lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers
0:41.934 default K starsurge Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(2), solar_empowerment(2), overwhelming_power(16), conch_of_dark_whispers
0:43.101 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(14)
0:44.070 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(13)
0:45.219 default R solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(12)
0:46.172 default P stellar_flare Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(11)
0:47.294 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(10)
0:48.728 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25)
0:50.090 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(23)
0:51.169 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(22)
0:52.061 default N sunfire Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21)
0:53.113 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20)
0:54.460 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19)
0:55.811 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(18)
0:56.876 default R solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(17)
0:57.785 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16)
0:59.152 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(14)
1:00.068 default H purifying_blast Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(13)
1:01.151 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(12)
1:02.077 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(6), overwhelming_power(11)
1:03.267 default O moonfire Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(10)
1:04.426 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(9)
1:05.908 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(8)
1:06.900 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(7), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(7)
1:08.072 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(5)
1:09.531 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(4)
1:10.510 default N sunfire Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(3)
1:11.666 default P stellar_flare Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(2)
1:12.825 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power
1:13.817 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(8), starlord(2), torrent_of_elements
1:14.985 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
1:15.826 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements
1:17.087 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power celestial_alignment, starlord(3), torrent_of_elements
1:18.076 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power celestial_alignment, starlord(3)
1:19.558 default M moonfire Fluffy_Pillow 62.0/100: 62% astral_power celestial_alignment, solar_empowerment, starlord(3)
1:20.545 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power solar_empowerment, starlord(3)
1:21.512 default R solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power starlord(3)
1:22.647 default K starsurge Fluffy_Pillow 83.0/100: 83% astral_power
1:23.885 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord
1:25.090 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:26.578 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2)
1:28.068 default N sunfire Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(2)
1:29.237 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(2)
1:30.231 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(2), solar_empowerment, starlord(2)
1:31.398 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
1:32.846 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3)
1:33.811 default P stellar_flare Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3)
1:34.947 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3)
1:35.913 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3)
1:37.050 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(3)
1:38.496 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3)
1:39.944 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3)
1:40.909 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(4), starlord(3)
1:42.046 default O moonfire Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(4), starlord(3)
1:43.182 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(4)
1:44.421 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
1:45.952 default N sunfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(5), solar_empowerment, starlord, torrent_of_elements
1:47.154 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), solar_empowerment, starlord, torrent_of_elements
1:48.176 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(5), lunar_empowerment, starlord, torrent_of_elements
1:49.379 default Q lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements
1:50.867 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
1:52.356 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), torrent_of_elements
1:53.350 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), torrent_of_elements
1:54.519 default Q lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
1:55.965 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements
1:56.934 default R solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements
1:57.901 default P stellar_flare Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(25)
1:58.941 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(24)
1:59.983 default H purifying_blast Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), overwhelming_power(23)
2:01.120 default Q lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), overwhelming_power(21)
2:02.464 default R solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(20)
2:03.522 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar(7), overwhelming_power(19)
2:04.677 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(18)
2:05.804 default G use_items Fluffy_Pillow 24.5/100: 25% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(17)
2:05.804 default N sunfire Fluffy_Pillow 24.5/100: 25% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(17), ignition_mages_fuse
2:06.721 default O moonfire Fluffy_Pillow 28.0/100: 28% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16), ignition_mages_fuse
2:07.644 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(15), ignition_mages_fuse
2:08.430 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(14), ignition_mages_fuse
2:09.357 default R solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(13), ignition_mages_fuse
2:10.127 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(24), ignition_mages_fuse(2)
2:11.199 default L sunfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(23), ignition_mages_fuse(2)
2:12.041 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), ignition_mages_fuse(2)
2:13.276 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(21), ignition_mages_fuse(2)
2:14.250 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20), ignition_mages_fuse(3)
2:15.452 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19), ignition_mages_fuse(3)
2:16.653 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(18), ignition_mages_fuse(3)
2:17.458 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(17), ignition_mages_fuse(3)
2:18.668 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(16), ignition_mages_fuse(4)
2:19.448 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(15), ignition_mages_fuse(4)
2:20.371 default R solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(14), ignition_mages_fuse(4)
2:21.296 default Q lunar_strike Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(13), ignition_mages_fuse(4)
2:22.478 default J cancel_buff Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(12), ignition_mages_fuse(5)
2:22.478 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(2), overwhelming_power(12), ignition_mages_fuse(5)
2:23.455 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(11), ignition_mages_fuse(5)
2:24.408 default P stellar_flare Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(10), ignition_mages_fuse(5)
2:25.336 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(9), ignition_mages_fuse(5)
2:26.524 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(8)
2:27.660 default O moonfire Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(7)
2:28.769 default R solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(6)
2:29.714 default N sunfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(5)
2:30.828 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(4)
2:32.254 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(2)
2:33.692 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power
2:34.824 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3)
2:35.791 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
2:37.239 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
2:38.206 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3)
2:39.174 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(6), starlord(3)
2:40.311 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(6), starlord(3)
2:41.448 default R solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(6), starlord(3)
2:42.584 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(6)
2:43.824 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord
2:45.356 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(7), solar_empowerment, starlord, conch_of_dark_whispers
2:46.559 default P stellar_flare Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
2:47.727 default N sunfire Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
2:48.895 default O moonfire Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
2:50.063 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
2:51.552 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(2), conch_of_dark_whispers
2:52.544 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
2:53.712 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:54.552 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:55.812 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:56.652 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:57.640 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:58.479 default L sunfire Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:59.468 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:00.914 default H purifying_blast Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3)
3:02.053 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3)
3:03.501 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, solar_empowerment(2)
3:04.740 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord
3:05.765 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord
3:07.296 default I celestial_alignment Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord
3:08.342 default E potion Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord
3:08.342 default F berserking Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord, battle_potion_of_intellect
3:08.342 default K starsurge Fluffy_Pillow 86.5/100: 87% astral_power berserking, arcanic_pulsar(2), celestial_alignment, solar_empowerment(2), starlord, battle_potion_of_intellect
3:09.293 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), battle_potion_of_intellect
3:10.080 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25), battle_potion_of_intellect
3:10.924 default O moonfire Fluffy_Pillow 20.0/100: 20% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(25), battle_potion_of_intellect
3:11.746 default P stellar_flare Fluffy_Pillow 23.5/100: 24% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24), battle_potion_of_intellect
3:12.569 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(23), battle_potion_of_intellect
3:13.322 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25), battle_potion_of_intellect
3:14.370 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), battle_potion_of_intellect
3:15.195 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(23), battle_potion_of_intellect
3:15.948 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), battle_potion_of_intellect
3:17.003 default N sunfire Fluffy_Pillow 35.0/100: 35% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), battle_potion_of_intellect
3:17.836 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), battle_potion_of_intellect
3:18.592 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), battle_potion_of_intellect
3:19.658 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power berserking, arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), battle_potion_of_intellect
3:20.413 default Q lunar_strike Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(5), celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(18), battle_potion_of_intellect
3:21.803 default R solar_wrath Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17), battle_potion_of_intellect
3:22.594 default J cancel_buff Fluffy_Pillow 94.0/100: 94% astral_power arcanic_pulsar(5), celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(16), battle_potion_of_intellect
3:22.594 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power arcanic_pulsar(5), celestial_alignment, torrent_of_elements, overwhelming_power(16), battle_potion_of_intellect
3:23.611 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(15), battle_potion_of_intellect
3:24.454 default K starsurge Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord, torrent_of_elements, overwhelming_power(14), battle_potion_of_intellect
3:25.447 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(13), battle_potion_of_intellect
3:26.270 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(12), battle_potion_of_intellect
3:27.509 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(11), conch_of_dark_whispers, battle_potion_of_intellect
3:28.631 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(10), conch_of_dark_whispers, battle_potion_of_intellect
3:30.027 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(8), conch_of_dark_whispers, battle_potion_of_intellect
3:31.433 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(7), conch_of_dark_whispers, battle_potion_of_intellect
3:32.375 default O moonfire Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(6), conch_of_dark_whispers, battle_potion_of_intellect
3:33.487 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(5), conch_of_dark_whispers
3:34.602 default N sunfire Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(4), conch_of_dark_whispers
3:35.721 default P stellar_flare Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(3), conch_of_dark_whispers
3:36.845 default Q lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(2), conch_of_dark_whispers
3:38.283 default R solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), conch_of_dark_whispers
3:39.250 default R solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), conch_of_dark_whispers
3:40.384 default J cancel_buff Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), conch_of_dark_whispers
3:40.384 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(8), lunar_empowerment, conch_of_dark_whispers
3:41.622 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, conch_of_dark_whispers
3:42.511 default Q lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power celestial_alignment, lunar_empowerment(3), starlord
3:43.843 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power celestial_alignment, lunar_empowerment(2), starlord
3:44.889 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2)
3:45.754 default Q lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2)
3:47.049 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2)
3:48.065 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3)
3:49.514 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3)
3:50.652 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3)
3:52.099 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:53.544 default N sunfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
3:54.682 default O moonfire Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
3:55.819 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
3:57.266 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3)
3:58.233 default P stellar_flare Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), conch_of_dark_whispers
3:59.369 default R solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), conch_of_dark_whispers
4:00.334 default R solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(3), starlord(3), conch_of_dark_whispers
4:01.473 default H purifying_blast Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar(3), lunar_empowerment, conch_of_dark_whispers
4:02.711 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(3), lunar_empowerment, conch_of_dark_whispers
4:03.949 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord, conch_of_dark_whispers
4:05.152 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers
4:06.640 default G use_items Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
4:06.640 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse
4:08.065 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse
4:09.183 default R solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse
4:10.110 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse
4:11.496 default N sunfire Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(2)
4:12.541 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(2)
4:13.873 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
4:14.917 default R solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), ignition_mages_fuse(3)
4:15.772 default O moonfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
4:16.776 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
4:18.055 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
4:19.333 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
4:20.154 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), ignition_mages_fuse(4)
4:20.976 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(7), starlord(3), ignition_mages_fuse(4)
4:21.943 default P stellar_flare Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), ignition_mages_fuse(4)
4:22.909 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(7), lunar_empowerment, ignition_mages_fuse(5)
4:23.923 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, ignition_mages_fuse(5)
4:24.907 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), ignition_mages_fuse(5)
4:25.659 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), ignition_mages_fuse(5)
4:26.719 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(25)
4:27.509 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(24)
4:28.696 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(23)
4:29.633 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22)
4:30.410 default L sunfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(21)
4:31.326 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(20)
4:32.675 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(19)
4:33.737 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(25)
4:35.062 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(23)
4:35.953 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23)
4:37.287 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21)
4:38.339 default O moonfire Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20)
4:39.396 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(19)
4:40.300 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), conch_of_dark_whispers
4:41.657 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers
4:43.019 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(3), solar_empowerment(2), overwhelming_power(15), conch_of_dark_whispers
4:44.191 default R solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(14), conch_of_dark_whispers
4:45.162 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(13), conch_of_dark_whispers
4:46.625 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord, overwhelming_power(12), conch_of_dark_whispers
4:47.775 default P stellar_flare Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord, overwhelming_power(11), conch_of_dark_whispers
4:48.929 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord, overwhelming_power(10), conch_of_dark_whispers
4:50.088 default R solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(8), conch_of_dark_whispers
4:51.052 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(7), conch_of_dark_whispers
4:52.500 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(6), conch_of_dark_whispers
4:53.473 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), overwhelming_power(5), conch_of_dark_whispers
4:54.449 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(2), overwhelming_power(4), conch_of_dark_whispers
4:55.600 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(3)
4:57.031 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power
4:58.474 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3)
4:59.440 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(6), starlord(3)
5:00.578 default O moonfire Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(6), starlord(3)
5:01.713 default H purifying_blast Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(6), starlord(3)
5:02.850 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(6), starlord(3)
5:03.986 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(6)
5:05.225 default N sunfire Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
5:06.428 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
5:07.631 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
5:09.120 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
5:10.611 default P stellar_flare Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
5:11.780 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
5:12.948 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
5:13.789 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
5:15.048 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power celestial_alignment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
5:16.034 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
5:16.874 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
5:18.134 default L sunfire Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
5:19.122 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
5:20.088 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements
5:21.055 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, starlord(3)
5:22.193 default O moonfire Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar, starlord(3)
5:23.330 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, starlord(3)
5:24.467 default K starsurge Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar
5:25.706 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord
5:27.236 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(2), solar_empowerment, starlord
5:28.436 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2)
5:29.923 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(2)
5:30.916 default R solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2)
5:31.911 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2)
5:32.906 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(3), starlord(2)
5:34.075 default P stellar_flare Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3)
5:35.211 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3)
5:36.660 default N sunfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3)
5:37.797 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3)
5:38.764 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(4), starlord(3)
5:39.901 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3)
5:41.346 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3)
5:42.312 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(5), starlord(3)
5:43.450 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), starlord(3)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="purification protocol"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

ripple in space : 40713 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
40713.3 40713.3 23.2 / 0.057% 4804.4 / 11.8% 4999.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 8.0 Astral Power 0.00% 58.4 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ripple in space 40713
Heed My Call 299 (427) 0.7% (1.0%) 8.3 32.61sec 15488 0 Direct 8.3 9128 18250 10846 18.8%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.25 8.25 0.00 0.00 0.0000 0.0000 89514.44 89514.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.70 81.16% 9127.52 8921 9813 9125.91 0 9813 61143 61143 0.00
crit 1.55 18.84% 18250.44 17842 19626 14495.36 0 19626 28371 28371 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 128 0.3% 8.3 32.61sec 4642 0 Direct 8.3 3911 7825 4642 18.7%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.25 8.25 0.00 0.00 0.0000 0.0000 38312.79 38312.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.71 81.33% 3911.40 3823 4206 3910.10 0 4206 26255 26255 0.00
crit 1.54 18.67% 7825.07 7646 8411 6210.06 0 8411 12058 12058 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5940 14.6% 76.8 3.80sec 23180 17859 Direct 76.8 19526 39045 23180 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.78 76.78 0.00 0.00 1.2980 0.0000 1779859.35 1779859.35 0.00 17858.60 17858.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.41 81.28% 19525.86 10135 25776 19534.34 18721 20643 1218628 1218628 0.00
crit 14.37 18.72% 39045.34 20270 51553 39062.77 35090 47514 561232 561232 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2927 7.2% 14.0 21.37sec 62440 61731 Direct 14.0 3379 6757 4012 18.7%  
Periodic 222.9 3101 6200 3681 18.7% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.04 14.04 222.90 222.90 1.0115 1.3312 876766.05 876766.05 0.00 2819.79 61731.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.41 81.26% 3378.66 2981 4328 3380.85 3088 3709 38551 38551 0.00
crit 2.63 18.74% 6757.05 5963 8656 6384.65 0 8656 17781 17781 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.2 81.30% 3101.48 2 4030 3102.91 3013 3253 562085 562085 0.00
crit 41.7 18.70% 6199.55 37 8059 6202.05 5711 6715 258348 258348 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Ripple in Space 420 1.0% 5.5 60.36sec 22943 20107 Direct 5.4 23095 0 23095 0.0%  

Stats details: ripple_in_space

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.48 5.44 0.00 0.00 1.1412 0.0000 125626.47 125626.47 0.00 20106.67 20106.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.44 100.00% 23094.61 22641 24905 23093.07 22641 24528 125626 125626 0.00
 
 

Action details: ripple_in_space

Static Values
  • id:302731
  • school:fire
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:302731
  • name:Ripple in Space
  • school:physical
  • tooltip:About to relocate with Ripple in Space.
  • description:Create an Azerite beacon at a target location. After {$d=4 seconds}, the Heart of Azeroth will relocate you to this beacon and deal {$s2=4952} Fire damage to all nearby enemies.$?a302780[ For {$302864d=10 seconds} after being relocated, you take {$302864s1=10}% reduced damage.][]
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:20572.62
  • base_dd_max:20572.62
  • base_dd_mult:1.00
 
Shooting Stars 939 2.3% 44.5 6.56sec 6330 0 Direct 44.5 5331 10658 6330 18.7%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.46 44.46 0.00 0.00 0.0000 0.0000 281410.32 281410.32 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.13 81.26% 5331.23 4769 6923 5333.71 4866 5806 192602 192602 0.00
crit 8.33 18.74% 10657.85 9539 13847 10655.91 0 13847 88808 88808 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3291 (5261) 8.1% (12.9%) 92.4 3.18sec 17060 19050 Direct 92.9 8945 17877 10611 18.7%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.38 92.89 0.00 0.00 0.8955 0.0000 985626.77 985626.77 0.00 19050.12 19050.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.56 81.35% 8944.99 7949 11539 8950.25 8578 9460 675885 675885 0.00
crit 17.33 18.65% 17876.52 15898 23078 17886.92 16082 20400 309742 309742 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1971 4.8% 74.0 3.96sec 7983 0 Direct 74.0 7983 0 7983 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.96 73.96 0.00 0.00 0.0000 0.0000 590408.41 590408.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.96 100.00% 7982.96 5962 17308 7986.91 6888 9393 590408 590408 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starsurge 13787 33.9% 60.9 4.95sec 67758 64988 Direct 60.7 57310 114482 67974 18.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.93 60.73 0.00 0.00 1.0426 0.0000 4128312.53 4128312.53 0.00 64988.23 64988.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.41 81.35% 57309.91 51347 73781 57335.75 54969 60386 2831408 2831408 0.00
crit 11.33 18.65% 114482.12 102695 147561 114507.47 102695 133716 1296905 1296905 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1896 4.7% 12.7 23.57sec 44557 43445 Direct 12.7 2823 5641 3343 18.5%  
Periodic 220.4 2009 4017 2384 18.7% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.75 12.75 220.42 220.42 1.0256 1.3348 568037.13 568037.13 0.00 1848.60 43444.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.40 81.55% 2823.16 2570 3731 2823.76 2621 3107 29349 29349 0.00
crit 2.35 18.45% 5641.08 5140 7462 5201.10 0 7462 13271 13271 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.3 81.34% 2009.12 3 2612 2010.06 1944 2107 360202 360202 0.00
crit 41.1 18.66% 4016.58 10 5223 4018.19 3761 4406 165215 165215 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5856 14.3% 89.7 3.08sec 19440 0 Direct 89.7 16389 32778 19441 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.73 89.73 0.00 0.00 0.0000 0.0000 1744356.58 1744356.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.02 81.38% 16388.53 16021 17623 16388.37 16021 17356 1196677 1196677 0.00
crit 16.71 18.62% 32778.27 32042 35246 32776.95 32042 34890 547680 547680 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3260 8.0% 18.0 16.52sec 54133 53212 Direct 18.0 4631 9261 5486 18.5%  
Periodic 222.0 3331 6658 3952 18.7% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.04 18.04 222.02 222.02 1.0173 1.3325 976379.37 976379.37 0.00 3107.60 53211.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.70 81.52% 4630.58 4112 5970 4631.16 4260 5005 68085 68085 0.00
crit 3.33 18.48% 9261.17 8225 11939 9004.98 0 11939 30870 30870 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.6 81.35% 3331.42 4 4328 3333.00 3230 3498 601686 601686 0.00
crit 41.4 18.65% 6658.18 4 8656 6660.57 6241 7456 275738 275738 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
ripple in space
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.54sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.62sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9024 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.2 53.6 44.3sec 5.0sec 92.81% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.53%
  • arcanic_pulsar_2:10.34%
  • arcanic_pulsar_3:10.97%
  • arcanic_pulsar_4:10.74%
  • arcanic_pulsar_5:13.82%
  • arcanic_pulsar_6:10.61%
  • arcanic_pulsar_7:10.77%
  • arcanic_pulsar_8:14.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 188.6sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.6sec 182.6sec 8.11% 7.79% 0.0(0.0) 2.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.5sec 37.5sec 25.84% 32.60% 0.0(0.0) 8.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.9sec 45.5sec 23.68% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.3sec 120.3sec 19.16% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.88%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.1 45.5 8.9sec 3.8sec 81.74% 99.68% 1.8(1.8) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.43%
  • lunar_empowerment_2:31.42%
  • lunar_empowerment_3:13.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.4 64.3sec 33.9sec 47.83% 0.00% 3.4(48.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.92%
  • overwhelming_power_14:1.98%
  • overwhelming_power_15:2.03%
  • overwhelming_power_16:2.09%
  • overwhelming_power_17:2.15%
  • overwhelming_power_18:2.22%
  • overwhelming_power_19:2.28%
  • overwhelming_power_20:2.35%
  • overwhelming_power_21:2.43%
  • overwhelming_power_22:2.50%
  • overwhelming_power_23:2.58%
  • overwhelming_power_24:2.65%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Reality Shift 5.4 0.0 60.4sec 60.4sec 35.16% 0.00% 105.2(105.2) 5.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_reality_shift
  • max_stacks:1
  • duration:20.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Buff details

  • stat:intellect
  • amount:805.18

Stack Uptimes

  • reality_shift_1:35.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302916
  • name:Reality Shift
  • tooltip:
  • description:$?a302961[Your movement speed is increased by {$302961s1=5}%, and when][When] you move more than {$s1=25} yds within {$s4=4} sec, gain {$s2=194} $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] for {$302952d=15 seconds}. This can only occur once every {$302953d=30 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Solar Empowerment 24.5 51.8 12.1sec 3.9sec 85.51% 79.73% 0.3(0.3) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.06%
  • solar_empowerment_2:39.57%
  • solar_empowerment_3:17.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.7 20.3sec 4.9sec 97.06% 92.03% 15.8(15.8) 11.3

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.82%
  • starlord_2:22.32%
  • starlord_3:59.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.3sec 45.8sec 23.60% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.60%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
ripple in space
starsurge Astral Power 60.9 2437.1 40.0 40.0 1693.9
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 93.38 747.02 (31.13%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.33%) 40.00 0.00 0.00%
sunfire Astral Power 18.04 54.11 (2.25%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.46 177.83 (7.41%) 4.00 0.01 0.01%
moonfire Astral Power 14.04 42.13 (1.76%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.75 101.99 (4.25%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.78 921.36 (38.40%) 12.00 0.06 0.01%
natures_balance Astral Power 400.36 200.18 (8.34%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.25 74.95 (3.12%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.00 8.13
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.80 0.00 68.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data ripple in space Fight Length
Count 11043
Mean 299.90
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data ripple in space Damage Per Second
Count 11043
Mean 40713.29
Minimum 36823.12
Maximum 46104.63
Spread ( max - min ) 9281.51
Range [ ( max - min ) / 2 * 100% ] 11.40%
Standard Deviation 1243.2507
5th Percentile 38769.65
95th Percentile 42839.95
( 95th Percentile - 5th Percentile ) 4070.30
Mean Distribution
Standard Deviation 11.8308
95.00% Confidence Intervall ( 40690.10 - 40736.48 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3583
0.1 Scale Factor Error with Delta=300 13195
0.05 Scale Factor Error with Delta=300 52779
0.01 Scale Factor Error with Delta=300 1319475
Priority Target DPS
Sample Data ripple in space Priority Target Damage Per Second
Count 11043
Mean 40713.29
Minimum 36823.12
Maximum 46104.63
Spread ( max - min ) 9281.51
Range [ ( max - min ) / 2 * 100% ] 11.40%
Standard Deviation 1243.2507
5th Percentile 38769.65
95th Percentile 42839.95
( 95th Percentile - 5th Percentile ) 4070.30
Mean Distribution
Standard Deviation 11.8308
95.00% Confidence Intervall ( 40690.10 - 40736.48 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3583
0.1 Scale Factor Error with Delta=300 13195
0.05 Scale Factor Error with Delta=300 52779
0.01 Scale Factor Error with Delta=300 1319475
DPS(e)
Sample Data ripple in space Damage Per Second (Effective)
Count 11043
Mean 40713.29
Minimum 36823.12
Maximum 46104.63
Spread ( max - min ) 9281.51
Range [ ( max - min ) / 2 * 100% ] 11.40%
Damage
Sample Data ripple in space Damage
Count 11043
Mean 12184610.20
Minimum 9462647.10
Maximum 15244028.66
Spread ( max - min ) 5781381.56
Range [ ( max - min ) / 2 * 100% ] 23.72%
DTPS
Sample Data ripple in space Damage Taken Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ripple in space Healing Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ripple in space Healing Per Second (Effective)
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ripple in space Heal
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ripple in space Healing Taken Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ripple in space Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data ripple in spaceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ripple in space Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
H 5.48 ripple_in_space
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.95 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.93 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.00 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.79 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.58 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.26 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.75 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 77.15 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 92.64 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.45 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRKRQKRQRQKRQRNRORQRSKPKRLQKQQRRRRRRRKRKRQRQJKMKNQPQKRQKRQQQRHKNOQRKRQPKRQQRRNRKRQKRQKOQQKPQNQRRQKKROQQKRQRKNQPQHRRKQGQKRQKRQRMNKQRRRQPRKQKRQRKNOQRRRKQRQRRKPQKNQOQKRQRKRHQRRIEFKNKRPRKRORQKRQRQRQRLRKKQQRQKPORQRKRQKRQLQKRQKRQKROPQHNQRGQJKRKRQRQKRQKNORPQQRQRKRKRQKLQQKQQKORQPRKQRNRKQRRRKHQORQRKNPQRKRQRKRMQQRRRNKKQRPQKRQRQKQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ripple in space 58.0/100: 58% astral_power
Pre precombat 1 food ripple in space 58.0/100: 58% astral_power
Pre precombat 2 augmentation ripple in space 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H ripple_in_space Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.238 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, battle_potion_of_intellect
0:02.191 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.115 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.040 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.966 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.770 default F berserking Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.770 default G use_items Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.770 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:06.525 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.278 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.032 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.786 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.628 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:10.384 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.139 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.892 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.646 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.402 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.156 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.911 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.664 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.420 default N sunfire Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.174 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.929 default O moonfire Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.684 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.440 default Q lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.216 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.968 default S sunfire Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.723 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, torrent_of_elements, overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.479 default P stellar_flare Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(16), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.235 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(25), ignition_mages_fuse(5)
0:23.988 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(25), ignition_mages_fuse(5)
0:24.744 default L sunfire Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(24), ignition_mages_fuse(5)
0:25.500 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(23), ignition_mages_fuse(5)
0:26.377 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(22)
0:27.208 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21)
0:28.243 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20)
0:29.279 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(19)
0:30.033 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(18)
0:30.786 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(18)
0:31.606 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(17)
0:32.428 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(16)
0:33.253 default R solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(15)
0:34.082 default R solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(14)
0:34.916 default K starsurge Fluffy_Pillow 99.0/100: 99% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(14)
0:35.749 default R solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(13)
0:36.504 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(12)
0:37.260 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(11)
0:38.015 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(10)
0:38.952 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(10)
0:39.708 default Q lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(9)
0:40.648 default J cancel_buff Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(8)
0:40.648 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, overwhelming_power(8)
0:41.453 default M moonfire Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(7)
0:42.472 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(6)
0:43.649 default N sunfire Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(5)
0:44.796 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(4)
0:46.262 default P stellar_flare Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(2)
0:47.423 default Q lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power
0:48.906 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2)
0:50.075 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:51.041 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:52.489 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
0:53.625 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:54.590 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(3)
0:56.036 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:57.482 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
0:58.931 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3)
0:59.897 default H ripple_in_space Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3)
1:01.138 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment
1:02.377 default N sunfire Fluffy_Pillow 19.5/100: 20% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord
1:03.579 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord
1:04.782 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord
1:06.314 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord
1:07.335 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord
1:08.537 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2)
1:09.530 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:11.018 default P stellar_flare Fluffy_Pillow 35.0/100: 35% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2)
1:12.186 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2)
1:13.354 default R solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:14.318 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:15.767 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
1:17.215 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment(2), starlord(3)
1:18.181 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment, starlord(3)
1:19.149 default N sunfire Fluffy_Pillow 60.5/100: 61% astral_power reality_shift, arcanic_pulsar(8), starlord(3)
1:20.285 default R solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power reality_shift, arcanic_pulsar(8), starlord(3)
1:21.421 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment
1:22.658 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord
1:23.548 default Q lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power celestial_alignment, lunar_empowerment(3), starlord
1:24.880 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power celestial_alignment, lunar_empowerment(2), starlord
1:25.926 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2)
1:26.790 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2)
1:28.084 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2)
1:29.101 default O moonfire Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3)
1:30.238 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3)
1:31.687 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3)
1:33.134 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3)
1:34.269 default P stellar_flare Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:35.404 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:36.851 default N sunfire Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
1:37.989 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
1:39.436 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3)
1:40.403 default R solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3)
1:41.369 default Q lunar_strike Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3)
1:42.817 default K starsurge Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(3), solar_empowerment
1:44.056 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord
1:45.259 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2)
1:46.252 default O moonfire Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:47.422 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:48.911 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2)
1:50.399 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2)
1:51.569 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3)
1:52.536 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
1:53.984 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(25)
1:54.868 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24)
1:55.911 default N sunfire Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23)
1:56.958 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22)
1:58.296 default P stellar_flare Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20)
1:59.354 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19)
2:00.705 default H ripple_in_space Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25)
2:01.746 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24)
2:02.631 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23)
2:03.521 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, torrent_of_elements, overwhelming_power(22)
2:04.665 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
2:06.084 default G use_items Fluffy_Pillow 31.0/100: 31% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers
2:06.084 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers, ignition_mages_fuse
2:07.457 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers, ignition_mages_fuse
2:08.537 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers, ignition_mages_fuse
2:09.317 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers, ignition_mages_fuse
2:10.491 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power reality_shift, celestial_alignment, solar_empowerment(2), starlord(2), overwhelming_power(15), conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.379 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(14), conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.132 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.237 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power reality_shift, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(12), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.991 default M moonfire Fluffy_Pillow 36.0/100: 36% astral_power reality_shift, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(12), conch_of_dark_whispers, ignition_mages_fuse(2)
2:14.864 default N sunfire Fluffy_Pillow 39.5/100: 40% astral_power reality_shift, arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(11), conch_of_dark_whispers, ignition_mages_fuse(3)
2:15.832 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power reality_shift, arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(10), conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.804 default Q lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9), conch_of_dark_whispers, ignition_mages_fuse(3)
2:18.046 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power reality_shift, arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(7), conch_of_dark_whispers, ignition_mages_fuse(3)
2:18.882 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power reality_shift, arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(7), ignition_mages_fuse(4)
2:19.687 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power reality_shift, arcanic_pulsar(2), starlord(3), overwhelming_power(6), ignition_mages_fuse(4)
2:20.635 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(5), ignition_mages_fuse(4)
2:21.849 default P stellar_flare Fluffy_Pillow 55.5/100: 56% astral_power reality_shift, arcanic_pulsar(2), starlord(3), overwhelming_power(4), ignition_mages_fuse(4)
2:22.803 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(3), ignition_mages_fuse(5)
2:23.726 default K starsurge Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(2), overwhelming_power(25), ignition_mages_fuse(5)
2:24.669 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), ignition_mages_fuse(5)
2:25.838 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, overwhelming_power(23), ignition_mages_fuse(5)
2:26.757 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(22)
2:27.676 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(21), conch_of_dark_whispers
2:29.056 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(19), conch_of_dark_whispers
2:29.986 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), overwhelming_power(19), conch_of_dark_whispers
2:31.077 default N sunfire Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers
2:32.145 default O moonfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16), conch_of_dark_whispers
2:33.216 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), conch_of_dark_whispers
2:34.588 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(14), conch_of_dark_whispers
2:35.506 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(13), conch_of_dark_whispers
2:36.426 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(12), conch_of_dark_whispers
2:37.515 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(11), conch_of_dark_whispers
2:38.606 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(10), conch_of_dark_whispers
2:40.001 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(8), conch_of_dark_whispers
2:40.940 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), overwhelming_power(8), conch_of_dark_whispers
2:42.346 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(6), conch_of_dark_whispers
2:43.458 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(5), conch_of_dark_whispers
2:44.573 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(6), lunar_empowerment, overwhelming_power(4), conch_of_dark_whispers
2:45.794 default P stellar_flare Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(3), conch_of_dark_whispers
2:46.984 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(2), conch_of_dark_whispers
2:48.504 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
2:49.707 default N sunfire Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
2:50.877 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
2:52.363 default O moonfire Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
2:53.531 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
2:55.020 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), conch_of_dark_whispers
2:56.190 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:57.030 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:58.289 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power celestial_alignment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:59.130 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power celestial_alignment, solar_empowerment, starlord(3)
3:00.117 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
3:00.958 default H ripple_in_space Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
3:01.947 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3)
3:03.396 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power reality_shift, arcanic_pulsar, solar_empowerment, starlord(3)
3:04.363 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power reality_shift, arcanic_pulsar, starlord(3)
3:05.501 default I celestial_alignment Fluffy_Pillow 48.5/100: 49% astral_power reality_shift, arcanic_pulsar, celestial_alignment
3:06.578 default E potion Fluffy_Pillow 89.0/100: 89% astral_power reality_shift, arcanic_pulsar, celestial_alignment
3:06.578 default F berserking Fluffy_Pillow 89.0/100: 89% astral_power reality_shift, arcanic_pulsar, celestial_alignment, battle_potion_of_intellect
3:06.578 default K starsurge Fluffy_Pillow 89.0/100: 89% astral_power berserking, reality_shift, arcanic_pulsar, celestial_alignment, battle_potion_of_intellect
3:07.559 default N sunfire Fluffy_Pillow 50.0/100: 50% astral_power berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
3:08.509 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
3:09.460 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
3:10.248 default P stellar_flare Fluffy_Pillow 22.5/100: 23% astral_power berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect
3:11.172 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, battle_potion_of_intellect
3:11.957 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, battle_potion_of_intellect
3:12.881 default R solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
3:13.646 default O moonfire Fluffy_Pillow 13.0/100: 13% astral_power berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:14.546 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:15.446 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:16.590 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:17.488 default R solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
3:18.252 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:19.396 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:20.383 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:21.642 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
3:22.630 default Q lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25), battle_potion_of_intellect
3:23.782 default R solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(5), celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(24), battle_potion_of_intellect
3:24.690 default L sunfire Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(5), celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(23), battle_potion_of_intellect
3:25.603 default R solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, overwhelming_power(22), battle_potion_of_intellect
3:26.652 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar(5), lunar_empowerment, overwhelming_power(24), battle_potion_of_intellect
3:27.789 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(23), battle_potion_of_intellect
3:28.896 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(22), battle_potion_of_intellect
3:30.272 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(20), battle_potion_of_intellect
3:31.658 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(19)
3:32.585 default Q lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(18)
3:33.979 default K starsurge Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(17)
3:35.078 default P stellar_flare Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(15)
3:36.155 default O moonfire Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(14)
3:37.235 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(13)
3:38.157 default Q lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(12)
3:39.543 default R solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(11)
3:40.472 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(10)
3:41.567 default R solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(9)
3:42.381 default Q lunar_strike Fluffy_Pillow 73.0/100: 73% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(8)
3:43.606 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(7)
3:44.569 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(6)
3:45.392 default Q lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(5)
3:46.627 default L sunfire Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(4)
3:47.601 default Q lunar_strike Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), overwhelming_power(3)
3:49.160 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), overwhelming_power
3:50.393 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord
3:51.415 default Q lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(24)
3:52.822 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(23)
3:53.929 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(22)
3:54.846 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21)
3:56.228 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24)
3:57.301 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(23)
3:58.190 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22)
3:59.240 default P stellar_flare Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(21)
4:00.292 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(20)
4:01.640 default H ripple_in_space Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19)
4:02.702 default N sunfire Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18)
4:03.765 default Q lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(17)
4:05.127 default R solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(15)
4:06.044 default G use_items Fluffy_Pillow 78.0/100: 78% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14)
4:06.044 default Q lunar_strike Fluffy_Pillow 78.0/100: 78% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14), ignition_mages_fuse
4:07.364 default J cancel_buff Fluffy_Pillow 90.5/100: 91% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(13), ignition_mages_fuse
4:07.364 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment(2), overwhelming_power(13), ignition_mages_fuse
4:08.496 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(12), ignition_mages_fuse
4:09.435 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(11), ignition_mages_fuse
4:10.543 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(10), ignition_mages_fuse(2)
4:11.426 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(9), ignition_mages_fuse(2)
4:12.753 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(8), ignition_mages_fuse(2)
4:13.641 default Q lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(7), ignition_mages_fuse(2)
4:14.977 default K starsurge Fluffy_Pillow 67.5/100: 68% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(6), ignition_mages_fuse(3)
4:15.988 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(5), ignition_mages_fuse(3)
4:16.827 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(4), ignition_mages_fuse(3)
4:18.089 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2), ignition_mages_fuse(4)
4:19.049 default N sunfire Fluffy_Pillow 14.5/100: 14% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power, ignition_mages_fuse(4)
4:20.013 default O moonfire Fluffy_Pillow 18.0/100: 18% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse(4)
4:20.979 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse(4)
4:21.800 default P stellar_flare Fluffy_Pillow 30.5/100: 31% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(4)
4:22.768 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(5)
4:23.953 default Q lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(5)
4:25.138 default R solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(5)
4:25.927 default Q lunar_strike Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(5)
4:27.112 default R solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
4:28.079 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(8), torrent_of_elements, conch_of_dark_whispers
4:29.315 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
4:30.206 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers
4:31.253 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), conch_of_dark_whispers
4:32.118 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), conch_of_dark_whispers
4:33.412 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), conch_of_dark_whispers
4:34.430 default L sunfire Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
4:35.419 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
4:36.868 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers
4:38.314 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
4:39.451 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:40.897 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:42.343 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3)
4:43.479 default O moonfire Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3)
4:44.617 default R solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3)
4:45.583 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
4:47.031 default P stellar_flare Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3)
4:48.168 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(4), solar_empowerment(2)
4:49.220 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(4), solar_empowerment
4:50.462 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord
4:51.994 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord
4:53.016 default N sunfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord
4:54.221 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord
4:55.242 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(5), solar_empowerment, starlord
4:56.445 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2)
4:57.933 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(2)
4:58.929 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2)
4:59.923 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2)
5:00.915 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(6), starlord(2)
5:02.082 default H ripple_in_space Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3)
5:03.219 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3)
5:04.666 default O moonfire Fluffy_Pillow 16.0/100: 16% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment, starlord(3)
5:05.802 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment, starlord(3)
5:06.769 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, starlord(3)
5:08.216 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power reality_shift, arcanic_pulsar(7), starlord(3)
5:09.352 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power reality_shift, arcanic_pulsar(7)
5:10.588 default N sunfire Fluffy_Pillow 11.0/100: 11% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord
5:11.790 default P stellar_flare Fluffy_Pillow 14.5/100: 14% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord
5:12.994 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord
5:14.524 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment, starlord
5:15.545 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power reality_shift, arcanic_pulsar(8), starlord
5:16.748 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2)
5:17.611 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power reality_shift, celestial_alignment, lunar_empowerment(2), starlord(2)
5:18.905 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power reality_shift, celestial_alignment, lunar_empowerment, starlord(2)
5:19.923 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power reality_shift, celestial_alignment, lunar_empowerment, starlord(2)
5:20.940 default R solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
5:21.782 default M moonfire Fluffy_Pillow 17.5/100: 18% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3)
5:22.771 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power reality_shift, arcanic_pulsar, lunar_empowerment(2), starlord(3)
5:24.220 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24)
5:25.549 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(23)
5:26.437 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar, starlord(3), overwhelming_power(22)
5:27.487 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar, starlord(3), overwhelming_power(21)
5:28.541 default N sunfire Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar, starlord(3), overwhelming_power(20)
5:29.600 default K starsurge Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar, overwhelming_power(19)
5:30.757 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(18)
5:31.884 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(17)
5:33.284 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(15)
5:34.224 default P stellar_flare Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(14)
5:35.335 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(13)
5:36.754 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), overwhelming_power(12)
5:37.871 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(11)
5:38.799 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10)
5:40.195 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(8)
5:41.133 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(7)
5:42.544 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(6)
5:43.654 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(5)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="ripple in space"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

unbound force : 41730 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
41730.3 41730.3 22.8 / 0.055% 4727.5 / 11.3% 5113.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 8.0 Astral Power 0.00% 58.5 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
unbound force 41730
Heed My Call 306 (438) 0.7% (1.1%) 8.2 33.25sec 15987 0 Direct 8.2 9125 18268 11189 22.6%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.21 8.21 0.00 0.00 0.0000 0.0000 91822.97 91822.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.36 77.43% 9124.76 8921 9813 9123.78 0 9813 57989 57989 0.00
crit 1.85 22.57% 18267.68 17842 19626 15484.09 0 19626 33834 33834 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 131 0.3% 8.2 33.25sec 4799 0 Direct 8.2 3911 7825 4799 22.7%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.21 8.21 0.00 0.00 0.0000 0.0000 39386.91 39386.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.35 77.31% 3911.24 3823 4206 3908.44 0 4206 24818 24818 0.00
crit 1.86 22.69% 7824.65 7646 8411 6667.38 0 8411 14569 14569 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5915 14.2% 76.9 3.80sec 23051 17745 Direct 76.9 19049 38016 23051 21.1%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.88 76.88 0.00 0.00 1.2990 0.0000 1772285.63 1772285.63 0.00 17745.39 17745.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.66 78.90% 19049.28 10135 24211 19057.31 18334 20050 1155572 1155572 0.00
crit 16.22 21.10% 38015.65 20270 48422 38028.32 35037 43259 616713 616713 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2936 7.0% 14.0 21.36sec 62673 62003 Direct 14.0 3281 6547 4009 22.3%  
Periodic 223.0 3024 6025 3691 22.2% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.03 14.03 223.02 223.02 1.0108 1.3305 879511.12 879511.12 0.00 2828.93 62002.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.91 77.72% 3281.24 2981 4065 3283.33 3010 3656 35790 35790 0.00
crit 3.13 22.28% 6546.54 5963 8130 6348.91 0 8130 20464 20464 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 173.4 77.75% 3023.77 2 3785 3025.12 2935 3169 524340 524340 0.00
crit 49.6 22.25% 6025.12 11 7570 6027.18 5650 6579 298917 298917 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 945 2.3% 44.5 6.54sec 6362 0 Direct 44.5 5199 10356 6362 22.5%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.50 44.50 0.00 0.00 0.0000 0.0000 283110.15 283110.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.47 77.46% 5198.99 4769 6503 5201.20 4887 5637 179219 179219 0.00
crit 10.03 22.54% 10356.16 9539 13006 10359.73 0 13006 103891 103891 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3281 (5239) 7.9% (12.6%) 92.9 3.16sec 16890 18830 Direct 93.4 8694 17367 10519 21.0%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.91 93.42 0.00 0.00 0.8969 0.0000 982755.09 982755.09 0.00 18830.35 18830.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.76 78.95% 8693.97 7949 10838 8698.77 8398 9189 641270 641270 0.00
crit 19.66 21.05% 17367.47 15898 21676 17377.90 15898 19308 341485 341485 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1958 4.7% 74.0 3.96sec 7923 0 Direct 74.0 7923 0 7923 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.03 74.03 0.00 0.00 0.0000 0.0000 586490.85 586490.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.03 100.00% 7922.81 5962 16257 7926.37 6652 9365 586491 586491 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starsurge 13820 33.1% 61.1 4.94sec 67765 64977 Direct 60.9 56005 111632 67989 21.5%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.07 60.87 0.00 0.00 1.0429 0.0000 4138597.19 4138597.19 0.00 64977.27 64977.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.76 78.46% 56004.91 51347 69612 56029.22 54021 59585 2674600 2674600 0.00
crit 13.11 21.54% 111631.96 102695 139223 111676.19 102695 125170 1463998 1463998 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1903 4.6% 12.7 23.57sec 44715 43653 Direct 12.7 2767 5525 3370 21.9%  
Periodic 220.5 1959 3905 2390 22.1% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.75 12.75 220.53 220.53 1.0243 1.3341 570026.28 570026.28 0.00 1855.20 43653.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.96 78.12% 2766.84 2570 3504 2767.47 2570 3055 27555 27555 0.00
crit 2.79 21.88% 5524.55 5140 7009 5270.94 0 7009 15407 15407 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 171.7 77.87% 1959.32 8 2453 1960.19 1902 2045 336471 336471 0.00
crit 48.8 22.13% 3905.31 41 4906 3906.88 3672 4188 190592 190592 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5922 14.1% 89.2 3.10sec 19776 0 Direct 89.2 16387 32787 19776 20.7%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.21 89.21 0.00 0.00 0.0000 0.0000 1764151.59 1764151.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.77 79.33% 16387.25 16021 17623 16387.24 16021 17415 1159732 1159732 0.00
crit 18.43 20.67% 32786.71 32042 35246 32786.73 32042 34890 604419 604419 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3272 7.8% 18.1 16.50sec 54253 53406 Direct 18.1 4508 8984 5504 22.2%  
Periodic 222.1 3248 6472 3964 22.2% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.06 18.06 222.15 222.15 1.0159 1.3318 979997.53 979997.53 0.00 3119.04 53405.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.05 77.77% 4508.49 4112 5607 4509.44 4216 4984 63331 63331 0.00
crit 4.02 22.23% 8984.26 8225 11214 8870.62 0 11214 36084 36084 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 172.8 77.79% 3247.71 4 4065 3249.16 3158 3413 561219 561219 0.00
crit 49.3 22.21% 6472.10 4 8130 6474.28 6126 7003 319363 319363 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
The Unbound Force 1341 3.2% 4.9 67.60sec 81653 74016 Periodic 60.3 1595 8208 6678 76.9% 3.3%

Stats details: the_unbound_force

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.93 0.00 39.32 60.27 1.1033 0.2500 402497.17 402497.17 0.00 26362.14 74015.66
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.9 23.12% 1594.58 105 1902 1592.71 1188 1831 22220 22220 0.00
crit 46.3 76.88% 8207.58 524 9509 8206.73 7525 9251 380277 380277 0.00
 
 

Action details: the_unbound_force

Static Values
  • id:298452
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.reckless_force.up|time<5
Spelldata
  • id:298452
  • name:The Unbound Force
  • school:fire
  • tooltip:
  • description:Unleash the forces within the Heart of Azeroth, causing shards of Azerite to strike your target for ${({$298407s3=378}*(({$d=2 seconds}/$t)+1)+{$298407s3=378})} Fire damage over {$d=2 seconds}. This damage is increased by {$s2=300}% if it critically strikes.$?a298456[ Each time The Unbound Force causes a critical strike, it immediately strikes the target with an additional Azerite shard, up to a maximum of $298456m2.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: the_unbound_force_tick

Static Values
  • id:298453
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:50.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:298453
  • name:The Unbound Force
  • school:fire
  • tooltip:
  • description:{$@spelldesc298452=Unleash the forces within the Heart of Azeroth, causing shards of Azerite to strike your target for ${({$298407s3=378}*(({$d=2 seconds}/$t)+1)+{$298407s3=378})} Fire damage over {$d=2 seconds}. This damage is increased by {$s2=300}% if it critically strikes.$?a298456[ Each time The Unbound Force causes a critical strike, it immediately strikes the target with an additional Azerite shard, up to a maximum of $298456m2.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1571.35
  • base_dd_max:1571.35
  • base_dd_mult:1.00
 
Simple Action Stats Execute Interval
unbound force
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.63sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.72sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8998 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.2 53.7 44.2sec 4.9sec 92.75% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.51%
  • arcanic_pulsar_2:10.42%
  • arcanic_pulsar_3:11.19%
  • arcanic_pulsar_4:10.62%
  • arcanic_pulsar_5:13.73%
  • arcanic_pulsar_6:10.53%
  • arcanic_pulsar_7:10.71%
  • arcanic_pulsar_8:14.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 188.7sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.6sec 182.6sec 8.11% 7.76% 0.0(0.0) 2.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.4sec 37.4sec 25.87% 32.52% 0.0(0.0) 8.1

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.8sec 45.5sec 23.60% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.3sec 120.3sec 19.16% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.88%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.7 46.1 9.0sec 3.8sec 82.08% 99.70% 1.9(1.9) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.78%
  • lunar_empowerment_2:31.91%
  • lunar_empowerment_3:14.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.5 64.3sec 33.7sec 48.09% 0.00% 3.5(48.7) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.63%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.88%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.99%
  • overwhelming_power_15:2.05%
  • overwhelming_power_16:2.11%
  • overwhelming_power_17:2.17%
  • overwhelming_power_18:2.23%
  • overwhelming_power_19:2.30%
  • overwhelming_power_20:2.37%
  • overwhelming_power_21:2.45%
  • overwhelming_power_22:2.52%
  • overwhelming_power_23:2.60%
  • overwhelming_power_24:2.67%
  • overwhelming_power_25:1.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Reckless Force 4.0 0.0 67.4sec 67.4sec 5.24% 0.00% 0.0(0.0) 3.9

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_reckless_force
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.70
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • reckless_force_1:5.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302932
  • name:Reckless Force
  • tooltip:Critical Strike increased by {$s1=50}%.
  • description:{$@spelldesc298407=When an ability fails to critically strike, you have a high chance to gain Reckless Force. When Reckless Force reaches {$302917u=20} stacks, your critical strike is increased by {$302932s1=50}% for {$302932d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Reckless Force (_counter) 4.9 83.6 67.3sec 3.4sec 91.61% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_reckless_force_counter
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • reckless_force_counter_1:5.63%
  • reckless_force_counter_2:5.24%
  • reckless_force_counter_3:5.20%
  • reckless_force_counter_4:5.09%
  • reckless_force_counter_5:5.06%
  • reckless_force_counter_6:5.00%
  • reckless_force_counter_7:4.94%
  • reckless_force_counter_8:4.96%
  • reckless_force_counter_9:4.84%
  • reckless_force_counter_10:4.77%
  • reckless_force_counter_11:4.77%
  • reckless_force_counter_12:4.69%
  • reckless_force_counter_13:4.66%
  • reckless_force_counter_14:4.62%
  • reckless_force_counter_15:4.54%
  • reckless_force_counter_16:4.46%
  • reckless_force_counter_17:4.44%
  • reckless_force_counter_18:4.36%
  • reckless_force_counter_19:4.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302917
  • name:Reckless Force
  • tooltip:Upon reaching {$u=20} stacks, you gain $302932s~1% Critical Strike for {$302932d=3 seconds}.
  • description:{$@spelldesc298407=When an ability fails to critically strike, you have a high chance to gain Reckless Force. When Reckless Force reaches {$302917u=20} stacks, your critical strike is increased by {$302932s1=50}% for {$302932d=3 seconds}.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Solar Empowerment 24.5 51.9 12.1sec 3.9sec 85.54% 79.35% 0.3(0.3) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:27.86%
  • solar_empowerment_2:39.95%
  • solar_empowerment_3:17.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.8 20.2sec 4.9sec 97.32% 92.22% 15.8(15.8) 11.2

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.39%
  • starlord_2:22.68%
  • starlord_3:60.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.0sec 45.5sec 23.67% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.67%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
unbound force
starsurge Astral Power 61.1 2442.9 40.0 40.0 1694.1
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 93.91 751.23 (31.23%) 8.00 0.06 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.33%) 40.00 0.00 0.00%
sunfire Astral Power 18.06 54.19 (2.25%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.50 178.01 (7.40%) 4.00 0.01 0.00%
moonfire Astral Power 14.03 42.10 (1.75%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.75 101.98 (4.24%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.88 922.56 (38.35%) 12.00 0.06 0.01%
natures_balance Astral Power 400.36 200.18 (8.32%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.26 75.18 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.02 8.15
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.82 0.00 79.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data unbound force Fight Length
Count 11043
Mean 299.90
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data unbound force Damage Per Second
Count 11043
Mean 41730.34
Minimum 37806.16
Maximum 47374.45
Spread ( max - min ) 9568.29
Range [ ( max - min ) / 2 * 100% ] 11.46%
Standard Deviation 1224.0588
5th Percentile 39801.88
95th Percentile 43816.56
( 95th Percentile - 5th Percentile ) 4014.68
Mean Distribution
Standard Deviation 11.6482
95.00% Confidence Intervall ( 41707.51 - 41753.17 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 34
0.1% Error 3306
0.1 Scale Factor Error with Delta=300 12791
0.05 Scale Factor Error with Delta=300 51163
0.01 Scale Factor Error with Delta=300 1279053
Priority Target DPS
Sample Data unbound force Priority Target Damage Per Second
Count 11043
Mean 41730.34
Minimum 37806.16
Maximum 47374.45
Spread ( max - min ) 9568.29
Range [ ( max - min ) / 2 * 100% ] 11.46%
Standard Deviation 1224.0588
5th Percentile 39801.88
95th Percentile 43816.56
( 95th Percentile - 5th Percentile ) 4014.68
Mean Distribution
Standard Deviation 11.6482
95.00% Confidence Intervall ( 41707.51 - 41753.17 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 34
0.1% Error 3306
0.1 Scale Factor Error with Delta=300 12791
0.05 Scale Factor Error with Delta=300 51163
0.01 Scale Factor Error with Delta=300 1279053
DPS(e)
Sample Data unbound force Damage Per Second (Effective)
Count 11043
Mean 41730.34
Minimum 37806.16
Maximum 47374.45
Spread ( max - min ) 9568.29
Range [ ( max - min ) / 2 * 100% ] 11.46%
Damage
Sample Data unbound force Damage
Count 11043
Mean 12490632.47
Minimum 9614117.07
Maximum 15353211.64
Spread ( max - min ) 5739094.57
Range [ ( max - min ) / 2 * 100% ] 22.97%
DTPS
Sample Data unbound force Damage Taken Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data unbound force Healing Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data unbound force Healing Per Second (Effective)
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data unbound force Heal
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data unbound force Healing Taken Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data unbound force Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data unbound forceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data unbound force Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
H 4.93 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 3.05 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 61.07 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.02 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.79 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.58 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.25 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.75 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 77.25 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 93.16 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.47 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRKRQKRQRKRQRNRQORQJKRKPRQKQQQRRRRKRKRQRQRLJKKOQRQKPRQKNRQQRRQKKHORQRKRNPQQRQRJKRQKRQKORQNQRKPRQRKRQKRQKNORQQKRQRQPRKRQNGRKRQRKRQKORQQRHRJKKNPQQKRQOQRKRQQRJKKNRQPKRQRKRMQQRNRKKQQIEFKRQKPRQORQNKRQRKRQKLQQKRQKRQMKPRQHQKNRQKRQQKRQROPRRNKQGKQRQKQRRRRRRRKNOPRKRKHQKQQRQKRQNQRORKKPQRQKRQRKNQRRQOKRKRQRLPKQQQKQRRQKHOQNRKQRPKQRRRRRK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask unbound force 58.0/100: 58% astral_power
Pre precombat 1 food unbound force 58.0/100: 58% astral_power
Pre precombat 2 augmentation unbound force 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H the_unbound_force Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.237 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, battle_potion_of_intellect
0:02.189 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.116 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.041 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter, battle_potion_of_intellect
0:04.967 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(2), battle_potion_of_intellect
0:05.772 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(2), battle_potion_of_intellect
0:05.772 default G use_items Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(2), battle_potion_of_intellect
0:05.772 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse
0:06.528 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse
0:07.282 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse
0:08.036 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse
0:08.792 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse
0:09.637 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse
0:10.391 default R solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.145 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.955 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.710 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.463 default R solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.217 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.996 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(5), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.751 default N sunfire Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, reckless_force_counter(5), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.506 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, reckless_force_counter(6), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.260 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, reckless_force_counter(7), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.039 default O moonfire Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(7), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.794 default R solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(7), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.547 default Q lunar_strike Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(7), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.373 default J cancel_buff Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(8), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.373 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, torrent_of_elements, reckless_force_counter(8), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.128 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(8), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.882 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, reckless_force_counter(8), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.638 default P stellar_flare Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, reckless_force_counter(8), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.393 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, reckless_force_counter(8), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.149 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, reckless_force_counter(8), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.966 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), reckless_force_counter(8), conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.722 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter(8), conch_of_dark_whispers, ignition_mages_fuse(5)
0:26.634 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(8), conch_of_dark_whispers
0:27.750 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(9), conch_of_dark_whispers
0:28.866 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), reckless_force_counter(9), conch_of_dark_whispers
0:29.620 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, arcanic_pulsar(8), starlord(3), reckless_force_counter(9), conch_of_dark_whispers
0:30.495 default R solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, arcanic_pulsar(8), starlord(3), reckless_force_counter(9), conch_of_dark_whispers
0:31.371 default R solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power bloodlust, arcanic_pulsar(8), starlord(3), reckless_force_counter(9), conch_of_dark_whispers
0:32.247 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(24), reckless_force_counter(10), conch_of_dark_whispers
0:33.050 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23), reckless_force_counter(10), conch_of_dark_whispers
0:33.803 default K starsurge Fluffy_Pillow 72.5/100: 73% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(23), reckless_force_counter(10), conch_of_dark_whispers
0:34.558 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), reckless_force_counter(11)
0:35.313 default Q lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(21), reckless_force_counter(12)
0:36.212 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(20), reckless_force_counter(12)
0:36.967 default Q lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(20), reckless_force_counter(12)
0:37.867 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(19), reckless_force_counter(12)
0:38.622 default L sunfire Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(18), reckless_force_counter(12)
0:39.378 default J cancel_buff Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(17), reckless_force_counter(12)
0:39.378 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, overwhelming_power(17), reckless_force_counter(12)
0:40.275 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(16), reckless_force_counter(12)
0:41.148 default O moonfire Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(15), reckless_force_counter(12)
0:42.255 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(14), reckless_force_counter(13)
0:43.670 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(13), reckless_force_counter(14), conch_of_dark_whispers
0:44.618 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(12), reckless_force_counter(14), conch_of_dark_whispers
0:46.042 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(10), reckless_force_counter(14), conch_of_dark_whispers
0:47.167 default P stellar_flare Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(9), reckless_force_counter(14), conch_of_dark_whispers
0:48.266 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(8), reckless_force_counter(14), conch_of_dark_whispers
0:49.205 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(7), reckless_force_counter(14), conch_of_dark_whispers
0:50.615 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(6), reckless_force_counter(15), conch_of_dark_whispers
0:51.728 default N sunfire Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(5), reckless_force_counter(15), conch_of_dark_whispers
0:52.844 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(4), reckless_force_counter(15), conch_of_dark_whispers
0:53.795 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(3), reckless_force_counter(16), conch_of_dark_whispers
0:55.226 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power, reckless_force_counter(17), conch_of_dark_whispers
0:56.669 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), reckless_force_counter(18), conch_of_dark_whispers
0:57.636 default R solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), reckless_force_counter(18), conch_of_dark_whispers
0:58.603 default Q lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), reckless_force_counter(18)
1:00.050 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar(5), solar_empowerment, reckless_force_counter(19)
1:01.288 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, reckless_force_counter(19)
1:02.491 default H the_unbound_force Fluffy_Pillow 12.5/100: 13% astral_power reckless_force, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), conch_of_dark_whispers
1:03.658 default O moonfire Fluffy_Pillow 13.0/100: 13% astral_power reckless_force, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), conch_of_dark_whispers
1:04.825 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power reckless_force, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(24), conch_of_dark_whispers
1:05.736 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23), conch_of_dark_whispers
1:07.106 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
1:08.028 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers
1:09.115 default R solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers
1:10.016 default N sunfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers
1:11.080 default P stellar_flare Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers
1:12.150 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16), reckless_force_counter, conch_of_dark_whispers
1:13.515 default Q lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15), reckless_force_counter(2), conch_of_dark_whispers
1:14.887 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(14), reckless_force_counter(3), conch_of_dark_whispers
1:15.806 default Q lunar_strike Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13), reckless_force_counter(3), conch_of_dark_whispers
1:17.188 default R solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(11), reckless_force_counter(4)
1:18.116 default J cancel_buff Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), reckless_force_counter(4)
1:18.116 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), torrent_of_elements, overwhelming_power(10), reckless_force_counter(4)
1:19.310 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(9), reckless_force_counter(4)
1:20.172 default Q lunar_strike Fluffy_Pillow 78.0/100: 78% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(8), reckless_force_counter(4)
1:21.466 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(7), reckless_force_counter(4)
1:22.487 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(6), reckless_force_counter(4)
1:23.332 default Q lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(5), reckless_force_counter(5)
1:24.605 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(4), reckless_force_counter(5)
1:25.606 default O moonfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(3), reckless_force_counter(6)
1:26.729 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(2), reckless_force_counter(6)
1:27.689 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power, reckless_force_counter(6)
1:29.131 default N sunfire Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(6)
1:30.267 default Q lunar_strike Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(8)
1:31.716 default R solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(8)
1:32.682 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(8)
1:33.818 default P stellar_flare Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(8)
1:34.955 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(8)
1:35.923 default Q lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(8)
1:37.371 default R solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(9)
1:38.338 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), reckless_force_counter(10)
1:39.576 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord, reckless_force_counter(10)
1:40.598 default Q lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord, reckless_force_counter(11)
1:42.130 default K starsurge Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, reckless_force_counter(11)
1:43.332 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), reckless_force_counter(11)
1:44.325 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(12)
1:45.812 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(12)
1:46.981 default N sunfire Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(13)
1:48.116 default O moonfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(13)
1:49.253 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(13)
1:50.219 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(13)
1:51.666 default Q lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(13), conch_of_dark_whispers
1:53.113 default K starsurge Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(13), conch_of_dark_whispers
1:54.250 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(13), conch_of_dark_whispers
1:55.216 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(15), conch_of_dark_whispers
1:56.663 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(15), conch_of_dark_whispers
1:57.627 default Q lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(15), conch_of_dark_whispers
1:59.074 default P stellar_flare Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), reckless_force_counter(15), conch_of_dark_whispers
2:00.313 default R solar_wrath Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), overwhelming_power(24), reckless_force_counter(16), conch_of_dark_whispers
2:01.279 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), overwhelming_power(23), reckless_force_counter(16), conch_of_dark_whispers
2:02.421 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord, overwhelming_power(22), reckless_force_counter(17), conch_of_dark_whispers
2:03.363 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(21), reckless_force_counter(17), conch_of_dark_whispers
2:04.784 default N sunfire Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(25), reckless_force_counter(17), conch_of_dark_whispers
2:05.883 default G use_items Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(24), reckless_force_counter(17), conch_of_dark_whispers
2:05.883 default R solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(24), reckless_force_counter(17), conch_of_dark_whispers, ignition_mages_fuse
2:06.783 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(23), reckless_force_counter(17), conch_of_dark_whispers, ignition_mages_fuse
2:07.847 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(22), reckless_force_counter(17), conch_of_dark_whispers, ignition_mages_fuse
2:08.614 default Q lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21), reckless_force_counter(17), conch_of_dark_whispers, ignition_mages_fuse
2:09.766 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(20), reckless_force_counter(17), conch_of_dark_whispers, ignition_mages_fuse
2:10.537 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(19), reckless_force_counter(17), conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.416 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(18), reckless_force_counter(17), conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.171 default Q lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(17), reckless_force_counter(18), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.262 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16), reckless_force_counter(18), conch_of_dark_whispers, ignition_mages_fuse(2)
2:14.123 default O moonfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(15), reckless_force_counter(18), conch_of_dark_whispers, ignition_mages_fuse(3)
2:15.079 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(14), reckless_force_counter(18), conch_of_dark_whispers, ignition_mages_fuse(3)
2:15.895 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14), reckless_force_counter(18), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.118 default Q lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12), reckless_force_counter(18), conch_of_dark_whispers, ignition_mages_fuse(3)
2:18.347 default R solar_wrath Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(11), reckless_force_counter(19), conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.142 default H the_unbound_force Fluffy_Pillow 83.5/100: 84% astral_power reckless_force, arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(10), conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.078 default R solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power reckless_force, arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(9), conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.877 default J cancel_buff Fluffy_Pillow 92.5/100: 93% astral_power reckless_force, arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(9), ignition_mages_fuse(4)
2:20.877 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power reckless_force, arcanic_pulsar(2), lunar_empowerment, overwhelming_power(9), ignition_mages_fuse(4)
2:21.900 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power reckless_force, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(8), ignition_mages_fuse(5)
2:22.862 default N sunfire Fluffy_Pillow 14.0/100: 14% astral_power reckless_force, arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(7), ignition_mages_fuse(5)
2:23.799 default P stellar_flare Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(6), ignition_mages_fuse(5)
2:24.740 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(5), ignition_mages_fuse(5)
2:25.941 default Q lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(4)
2:27.407 default K starsurge Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(2)
2:28.565 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power
2:29.528 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter
2:30.976 default O moonfire Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter
2:32.112 default Q lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(2)
2:33.560 default R solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, reckless_force_counter(3)
2:34.526 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(3)
2:35.663 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, reckless_force_counter(3)
2:36.628 default Q lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(4)
2:38.078 default Q lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(4)
2:39.524 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(4)
2:40.490 default J cancel_buff Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(4)
2:40.490 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar(6), solar_empowerment, torrent_of_elements, reckless_force_counter(4)
2:41.730 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, reckless_force_counter(4)
2:42.931 default N sunfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, reckless_force_counter(4)
2:44.099 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), reckless_force_counter(5)
2:45.094 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(5)
2:46.582 default P stellar_flare Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(5), conch_of_dark_whispers
2:47.751 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(5), conch_of_dark_whispers
2:48.918 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(5), conch_of_dark_whispers
2:49.759 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(5), conch_of_dark_whispers
2:51.018 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(5), conch_of_dark_whispers
2:51.858 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(5), conch_of_dark_whispers
2:52.846 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(5), conch_of_dark_whispers
2:53.688 default M moonfire Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(6), conch_of_dark_whispers
2:54.675 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(6), conch_of_dark_whispers
2:56.123 default Q lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(6), conch_of_dark_whispers
2:57.570 default R solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), reckless_force_counter(7), conch_of_dark_whispers
2:58.536 default N sunfire Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar, solar_empowerment, starlord(3), reckless_force_counter(8), conch_of_dark_whispers
2:59.673 default R solar_wrath Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar, solar_empowerment, starlord(3), reckless_force_counter(8), conch_of_dark_whispers
3:00.641 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power arcanic_pulsar, reckless_force_counter(8), conch_of_dark_whispers
3:01.879 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(8), conch_of_dark_whispers
3:03.081 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(8), conch_of_dark_whispers
3:04.568 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(9), conch_of_dark_whispers
3:06.056 default I celestial_alignment Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(3), celestial_alignment, solar_empowerment(2), starlord(2), reckless_force_counter(9), conch_of_dark_whispers
3:07.072 default E potion Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(3), celestial_alignment, solar_empowerment(2), starlord(2), reckless_force_counter(9), conch_of_dark_whispers
3:07.072 default F berserking Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(3), celestial_alignment, solar_empowerment(2), starlord(2), reckless_force_counter(9), conch_of_dark_whispers, battle_potion_of_intellect
3:07.072 default K starsurge Fluffy_Pillow 82.5/100: 83% astral_power berserking, arcanic_pulsar(3), celestial_alignment, solar_empowerment(2), starlord(2), reckless_force_counter(9), conch_of_dark_whispers, battle_potion_of_intellect
3:07.995 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(9), conch_of_dark_whispers, battle_potion_of_intellect
3:08.759 default Q lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(9), conch_of_dark_whispers, battle_potion_of_intellect
3:09.903 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(9), conch_of_dark_whispers, battle_potion_of_intellect
3:10.802 default P stellar_flare Fluffy_Pillow 25.0/100: 25% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(9), conch_of_dark_whispers, battle_potion_of_intellect
3:11.701 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(10), conch_of_dark_whispers, battle_potion_of_intellect
3:12.466 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(10), conch_of_dark_whispers, battle_potion_of_intellect
3:13.611 default O moonfire Fluffy_Pillow 59.0/100: 59% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(10), conch_of_dark_whispers, battle_potion_of_intellect
3:14.511 default R solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(10), conch_of_dark_whispers, battle_potion_of_intellect
3:15.274 default Q lunar_strike Fluffy_Pillow 75.0/100: 75% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(10), conch_of_dark_whispers, battle_potion_of_intellect
3:16.418 default N sunfire Fluffy_Pillow 87.5/100: 88% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(10), conch_of_dark_whispers, battle_potion_of_intellect
3:17.315 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(10), conch_of_dark_whispers, battle_potion_of_intellect
3:18.214 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(10), conch_of_dark_whispers, battle_potion_of_intellect
3:18.979 default Q lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(11), battle_potion_of_intellect
3:20.124 default R solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(12), battle_potion_of_intellect
3:20.964 default K starsurge Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), torrent_of_elements, reckless_force_counter(13), battle_potion_of_intellect
3:22.040 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(13), battle_potion_of_intellect
3:22.929 default Q lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord, torrent_of_elements, reckless_force_counter(13), battle_potion_of_intellect
3:24.260 default K starsurge Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(24), reckless_force_counter(13), battle_potion_of_intellect
3:25.221 default L sunfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(23), reckless_force_counter(13), battle_potion_of_intellect
3:26.157 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(22), reckless_force_counter(13), battle_potion_of_intellect
3:27.531 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21), reckless_force_counter(14), battle_potion_of_intellect
3:28.914 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(20), reckless_force_counter(15), battle_potion_of_intellect
3:30.000 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(19), reckless_force_counter(15), battle_potion_of_intellect
3:30.785 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), reckless_force_counter(15), battle_potion_of_intellect
3:31.964 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), reckless_force_counter(15), battle_potion_of_intellect
3:32.893 default R solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(16), reckless_force_counter(16)
3:33.686 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15), reckless_force_counter(17)
3:34.878 default M moonfire Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14), reckless_force_counter(17)
3:35.817 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13), reckless_force_counter(17)
3:36.900 default P stellar_flare Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(12), reckless_force_counter(17)
3:37.985 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(11), reckless_force_counter(18)
3:38.912 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(10), reckless_force_counter(19)
3:40.307 default H the_unbound_force Fluffy_Pillow 36.5/100: 37% astral_power reckless_force, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8)
3:41.410 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power reckless_force, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), overwhelming_power(7)
3:42.949 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power reckless_force, arcanic_pulsar(2), solar_empowerment(2), overwhelming_power(6)
3:44.160 default N sunfire Fluffy_Pillow 11.0/100: 11% astral_power reckless_force, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(4)
3:45.343 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(3), reckless_force_counter(2)
3:46.356 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(2), reckless_force_counter(2)
3:47.878 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power, reckless_force_counter(2)
3:49.074 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), reckless_force_counter(2)
3:50.068 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(4)
3:51.555 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(4)
3:53.044 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), reckless_force_counter(4)
3:54.211 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(5)
3:55.177 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(5)
3:56.625 default R solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), reckless_force_counter(6)
3:57.590 default O moonfire Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), reckless_force_counter(6)
3:58.726 default P stellar_flare Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), reckless_force_counter(6)
3:59.864 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), reckless_force_counter(7)
4:00.830 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(5), starlord(3), reckless_force_counter(9)
4:01.966 default N sunfire Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(5), starlord(3), reckless_force_counter(9)
4:03.103 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(5), reckless_force_counter(9)
4:04.340 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(9)
4:05.872 default G use_items Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(6), solar_empowerment, starlord, reckless_force_counter(9)
4:05.872 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(6), solar_empowerment, starlord, reckless_force_counter(9), ignition_mages_fuse
4:07.023 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(9), ignition_mages_fuse
4:08.447 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), reckless_force_counter(10), ignition_mages_fuse
4:09.397 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(25), reckless_force_counter(11), ignition_mages_fuse
4:10.704 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), overwhelming_power(24), reckless_force_counter(11), ignition_mages_fuse(2)
4:11.697 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), reckless_force_counter(13), ignition_mages_fuse(2)
4:12.930 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(22), reckless_force_counter(14), ignition_mages_fuse(2)
4:13.755 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(21), reckless_force_counter(15), ignition_mages_fuse(2)
4:14.586 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(20), reckless_force_counter(15), ignition_mages_fuse(3)
4:15.527 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(19), reckless_force_counter(15), ignition_mages_fuse(3)
4:16.474 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(18), reckless_force_counter(15), ignition_mages_fuse(3)
4:17.422 default R solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(17), reckless_force_counter(15), ignition_mages_fuse(3)
4:18.372 default R solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(16), reckless_force_counter(15), ignition_mages_fuse(4)
4:19.291 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(15), reckless_force_counter(15), ignition_mages_fuse(4)
4:20.212 default N sunfire Fluffy_Pillow 68.0/100: 68% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(14), reckless_force_counter(15), ignition_mages_fuse(4)
4:21.017 default O moonfire Fluffy_Pillow 72.0/100: 72% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(13), reckless_force_counter(16), ignition_mages_fuse(4)
4:21.824 default P stellar_flare Fluffy_Pillow 75.5/100: 76% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(13), reckless_force_counter(17), ignition_mages_fuse(4)
4:22.630 default R solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(12), reckless_force_counter(18), ignition_mages_fuse(5)
4:23.384 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power reckless_force, celestial_alignment, lunar_empowerment, overwhelming_power(11), ignition_mages_fuse(5)
4:24.241 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power reckless_force, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(10), ignition_mages_fuse(5)
4:24.996 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power reckless_force, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(10), ignition_mages_fuse(5)
4:25.827 default H the_unbound_force Fluffy_Pillow 30.0/100: 30% astral_power reckless_force, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(9), conch_of_dark_whispers, ignition_mages_fuse(5)
4:26.637 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power reckless_force, arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(8), conch_of_dark_whispers
4:28.081 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(6), conch_of_dark_whispers
4:29.222 default Q lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(5), reckless_force_counter, conch_of_dark_whispers
4:30.641 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(4), reckless_force_counter, conch_of_dark_whispers
4:32.068 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(2), reckless_force_counter(2), conch_of_dark_whispers
4:33.027 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power, reckless_force_counter(2), conch_of_dark_whispers
4:34.471 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(2), conch_of_dark_whispers
4:35.608 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(2), conch_of_dark_whispers
4:36.574 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(2), conch_of_dark_whispers
4:38.023 default N sunfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(2), conch_of_dark_whispers
4:39.159 default Q lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(3), conch_of_dark_whispers
4:40.608 default R solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), reckless_force_counter(3)
4:41.574 default O moonfire Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), reckless_force_counter(3)
4:42.709 default R solar_wrath Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), reckless_force_counter(3)
4:43.675 default K starsurge Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(4), reckless_force_counter(3)
4:44.912 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(3)
4:46.116 default P stellar_flare Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(3)
4:47.287 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(3)
4:48.775 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), reckless_force_counter(4)
4:49.769 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(5)
4:51.257 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), reckless_force_counter(7)
4:52.425 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(7)
4:53.391 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(7)
4:54.839 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), reckless_force_counter(8)
4:55.804 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), reckless_force_counter(9)
4:56.940 default N sunfire Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(10)
4:58.078 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(11)
4:59.527 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), reckless_force_counter(11)
5:00.494 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), reckless_force_counter(11)
5:01.459 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), reckless_force_counter(11)
5:02.906 default O moonfire Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), starlord(3), reckless_force_counter(13)
5:04.042 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(8), reckless_force_counter(13)
5:05.281 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(13)
5:06.173 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power celestial_alignment, lunar_empowerment, starlord, reckless_force_counter(13)
5:07.220 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), reckless_force_counter(13)
5:08.085 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), reckless_force_counter(13)
5:09.380 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), reckless_force_counter(14)
5:10.397 default L sunfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), reckless_force_counter(14)
5:11.414 default P stellar_flare Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, lunar_empowerment(2), starlord(2), reckless_force_counter(14)
5:12.583 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, lunar_empowerment(2), starlord(2), reckless_force_counter(15)
5:13.751 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter(15)
5:15.199 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(16)
5:16.648 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(16)
5:18.095 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), reckless_force_counter(17)
5:19.231 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(17)
5:20.681 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), reckless_force_counter(17)
5:21.649 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), reckless_force_counter(18)
5:22.615 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), reckless_force_counter(18)
5:24.063 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(3), reckless_force_counter(18)
5:25.302 default H the_unbound_force Fluffy_Pillow 16.5/100: 17% astral_power reckless_force, arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord
5:26.503 default O moonfire Fluffy_Pillow 17.5/100: 18% astral_power reckless_force, arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord
5:27.705 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power reckless_force, arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord
5:29.236 default N sunfire Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(4), solar_empowerment, starlord, overwhelming_power(25), reckless_force_counter, conch_of_dark_whispers
5:30.335 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(4), solar_empowerment, starlord, overwhelming_power(24), reckless_force_counter, conch_of_dark_whispers
5:31.274 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(4), starlord, torrent_of_elements, overwhelming_power(23), reckless_force_counter, conch_of_dark_whispers
5:32.381 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(22), reckless_force_counter, conch_of_dark_whispers
5:33.756 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(21), reckless_force_counter, conch_of_dark_whispers
5:34.677 default P stellar_flare Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(5), starlord(2), torrent_of_elements, overwhelming_power(20), reckless_force_counter, conch_of_dark_whispers
5:35.764 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(5), starlord(2), torrent_of_elements, overwhelming_power(19), reckless_force_counter, conch_of_dark_whispers
5:36.857 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18), reckless_force_counter, conch_of_dark_whispers
5:38.216 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16), reckless_force_counter, conch_of_dark_whispers
5:39.127 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power(15), reckless_force_counter(2), conch_of_dark_whispers
5:40.204 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power(14), reckless_force_counter(2), conch_of_dark_whispers
5:41.282 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power(13), reckless_force_counter(3), conch_of_dark_whispers
5:42.365 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power(12), reckless_force_counter(3), conch_of_dark_whispers
5:43.453 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power(11), reckless_force_counter(3)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="unbound force"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

visions : 44863 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
44863.1 44863.1 35.9 / 0.080% 7544.8 / 16.8% 5193.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.6 8.5 Astral Power 0.00% 59.5 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
visions 44863
Heed My Call 307 (438) 0.7% (1.0%) 8.4 32.85sec 15642 0 Direct 8.4 9222 18449 10946 18.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.41 8.41 0.00 0.00 0.0000 0.0000 92010.83 92010.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.83 81.31% 9221.97 9012 9913 9221.32 0 9913 63029 63029 0.00
crit 1.57 18.69% 18448.64 18024 19826 14701.65 0 19826 28982 28982 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 132 0.3% 8.4 32.85sec 4695 0 Direct 8.4 3952 7906 4695 18.8%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.41 8.41 0.00 0.00 0.0000 0.0000 39466.86 39466.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.83 81.21% 3952.37 3862 4248 3952.46 0 4248 26979 26979 0.00
crit 1.58 18.79% 7905.67 7725 8497 6343.21 0 8497 12488 12488 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6185 13.8% 79.8 3.67sec 23223 18204 Direct 79.8 19564 39113 23223 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.84 79.84 0.00 0.00 1.2757 0.0000 1854232.55 1854232.55 0.00 18204.45 18204.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.90 81.28% 19563.52 10238 24458 19564.52 18718 20652 1269584 1269584 0.00
crit 14.95 18.72% 39112.80 20477 48917 39118.75 34145 45079 584648 584648 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3001 6.7% 14.3 21.21sec 63044 63073 Direct 14.3 3340 6681 3964 18.7%  
Periodic 228.2 3115 6226 3695 18.7% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.27 14.27 228.16 228.16 0.9996 1.3049 899604.09 899604.09 0.00 2883.53 63072.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.60 81.32% 3339.55 3012 4107 3339.36 3071 3643 38753 38753 0.00
crit 2.67 18.68% 6681.29 6024 8213 6315.07 0 8213 17807 17807 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 185.6 81.35% 3114.62 13 3823 3114.67 3017 3271 578074 578074 0.00
crit 42.6 18.65% 6225.93 4 7647 6225.91 5841 6698 264970 264970 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 966 2.2% 45.6 6.41sec 6350 0 Direct 45.6 5355 10702 6350 18.6%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.59 45.59 0.00 0.00 0.0000 0.0000 289467.75 289467.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.11 81.40% 5355.05 4818 6569 5354.97 4953 5745 198710 198710 0.00
crit 8.48 18.60% 10702.19 9636 13139 10697.26 0 13139 90758 90758 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3417 (5511) 7.6% (12.3%) 95.6 3.09sec 17293 19653 Direct 96.1 8990 17972 10660 18.6%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.56 96.09 0.00 0.00 0.8800 0.0000 1024360.22 1024360.22 0.00 19652.64 19652.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.23 81.41% 8990.00 8030 10949 8991.21 8635 9504 703283 703283 0.00
crit 17.87 18.59% 17971.99 16060 21898 17972.96 16378 19885 321077 321077 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2095 4.7% 78.3 3.75sec 8020 0 Direct 78.3 8020 0 8020 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.33 78.33 0.00 0.00 0.0000 0.0000 628229.97 628229.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.33 100.00% 8019.75 6023 16423 8019.31 6911 9560 628230 628230 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6022.59
  • base_dd_max:6022.59
  • base_dd_mult:1.00
 
Starsurge 14736 32.8% 64.8 4.67sec 68208 66651 Direct 64.5 57754 115453 68460 18.6%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.78 64.54 0.00 0.00 1.0234 0.0000 4418702.49 4418702.49 0.00 66651.12 66651.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.57 81.45% 57754.08 51872 70323 57750.04 55515 61418 3036069 3036069 0.00
crit 11.98 18.55% 115453.14 103744 140646 115433.61 103744 130056 1382633 1382633 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1947 4.3% 12.8 23.56sec 45622 44708 Direct 12.8 2844 5694 3372 18.5%  
Periodic 225.7 2019 4035 2395 18.7% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.79 12.79 225.73 225.73 1.0205 1.3077 583713.55 583713.55 0.00 1893.71 44708.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.42 81.47% 2843.99 2596 3540 2843.93 2625 3141 29645 29645 0.00
crit 2.37 18.53% 5693.77 5193 7081 5269.87 0 7081 13500 13500 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 183.6 81.34% 2018.50 4 2478 2018.53 1954 2119 370610 370610 0.00
crit 42.1 18.66% 4034.84 64 4956 4034.75 3793 4339 169959 169959 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 8742 19.5% 133.7 2.15sec 19650 0 Direct 133.7 16563 33131 19650 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 133.67 133.67 0.00 0.00 0.0000 0.0000 2626629.03 2626629.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 108.77 81.37% 16562.59 16184 17803 16562.64 16184 17391 1801491 1801491 0.00
crit 24.91 18.63% 33131.09 32369 35606 33131.33 32369 35265 825138 825138 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3338 7.4% 18.0 16.69sec 55653 55652 Direct 18.0 4627 9253 5489 18.6%  
Periodic 227.3 3345 6687 3968 18.7% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.98 17.98 227.29 227.29 1.0000 1.3058 1000676.77 1000676.77 0.00 3179.02 55651.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.63 81.36% 4626.73 4154 5664 4626.01 4278 5100 67681 67681 0.00
crit 3.35 18.64% 9252.99 8309 11329 8977.69 0 11329 31018 31018 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.9 81.35% 3345.08 2 4107 3345.14 3231 3510 618498 618498 0.00
crit 42.4 18.65% 6686.85 22 8213 6686.69 6117 7159 283479 283479 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
visions
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Berserking 2.0 190.41sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.5 149.41sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.46 0.00 0.00 0.00 0.9048 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.6 56.9 42.1sec 4.7sec 93.23% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.14%
  • arcanic_pulsar_2:10.74%
  • arcanic_pulsar_3:11.61%
  • arcanic_pulsar_4:11.10%
  • arcanic_pulsar_5:13.00%
  • arcanic_pulsar_6:10.92%
  • arcanic_pulsar_7:11.12%
  • arcanic_pulsar_8:13.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 110.6sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 190.8sec 190.8sec 8.11% 7.96% 0.0(0.0) 2.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 10.0 0.0 31.1sec 31.1sec 39.46% 47.21% 0.0(0.0) 9.5

Buff details

  • buff initial source:visions
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:39.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.1 61.1sec 45.7sec 23.56% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.5 0.0 149.5sec 149.5sec 15.72% 0.00% 2.3(2.3) 2.3

Buff details

  • buff initial source:visions
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.23%
  • ignition_mages_fuse_2:3.19%
  • ignition_mages_fuse_3:3.14%
  • ignition_mages_fuse_4:3.10%
  • ignition_mages_fuse_5:3.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 29.6 54.4 10.1sec 3.6sec 85.64% 98.90% 3.3(3.3) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:32.65%
  • lunar_empowerment_2:32.64%
  • lunar_empowerment_3:20.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.6 64.3sec 33.3sec 48.67% 0.00% 3.6(50.2) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.55%
  • overwhelming_power_6:1.59%
  • overwhelming_power_7:1.64%
  • overwhelming_power_8:1.69%
  • overwhelming_power_9:1.73%
  • overwhelming_power_10:1.79%
  • overwhelming_power_11:1.84%
  • overwhelming_power_12:1.90%
  • overwhelming_power_13:1.95%
  • overwhelming_power_14:2.01%
  • overwhelming_power_15:2.07%
  • overwhelming_power_16:2.13%
  • overwhelming_power_17:2.20%
  • overwhelming_power_18:2.27%
  • overwhelming_power_19:2.34%
  • overwhelming_power_20:2.41%
  • overwhelming_power_21:2.49%
  • overwhelming_power_22:2.56%
  • overwhelming_power_23:2.64%
  • overwhelming_power_24:2.72%
  • overwhelming_power_25:1.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 28.3 52.4 10.5sec 3.7sec 84.57% 81.60% 0.3(0.3) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:30.59%
  • solar_empowerment_2:37.94%
  • solar_empowerment_3:16.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.4 49.4 20.1sec 4.7sec 98.01% 93.08% 18.9(18.9) 10.7

Buff details

  • buff initial source:visions
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:13.93%
  • starlord_2:21.86%
  • starlord_3:62.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.2sec 45.7sec 23.68% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.68%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Vision of Perfection 4.0 0.6 60.9sec 51.1sec 14.20% 0.00% 0.6(0.6) 3.9

Buff details

  • buff initial source:visions
  • cooldown name:buff_vision_of_perfection
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:123.79

Stack Uptimes

  • vision_of_perfection_1:14.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:303344
  • name:Vision of Perfection
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc303342=When Vision of Perfection activates, you and {$s1=2} other nearby allies gain {$s2=0} Haste for {$303344d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:visions
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:visions
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:visions
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:visions
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:visions
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
visions
starsurge Astral Power 64.8 2591.3 40.0 40.0 1705.2
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 96.56 771.98 (30.21%) 7.99 0.51 0.07%
celestial_alignment Astral Power 2.46 98.37 (3.85%) 40.00 0.00 0.00%
sunfire Astral Power 17.98 53.94 (2.11%) 3.00 0.00 0.00%
shooting_stars Astral Power 45.59 182.32 (7.14%) 4.00 0.03 0.02%
moonfire Astral Power 14.27 42.81 (1.68%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.79 102.34 (4.01%) 8.00 0.02 0.02%
lunar_strike Astral Power 79.84 957.60 (37.48%) 11.99 0.51 0.05%
natures_balance Astral Power 400.36 200.17 (7.83%) 0.50 0.01 0.01%
arcanic_pulsar Astral Power 6.72 80.70 (3.16%) 12.00 0.00 0.00%
vision_of_perfection Astral Power 4.64 64.89 (2.54%) 13.97 0.12 0.19%
Resource RPS-Gain RPS-Loss
Astral Power 8.52 8.64
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.31 0.00 95.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data visions Fight Length
Count 11043
Mean 299.90
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data visions Damage Per Second
Count 11043
Mean 44863.12
Minimum 38471.00
Maximum 54180.87
Spread ( max - min ) 15709.88
Range [ ( max - min ) / 2 * 100% ] 17.51%
Standard Deviation 1923.4602
5th Percentile 41895.68
95th Percentile 48193.12
( 95th Percentile - 5th Percentile ) 6297.44
Mean Distribution
Standard Deviation 18.3037
95.00% Confidence Intervall ( 44827.25 - 44899.00 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 71
0.1% Error 7062
0.1 Scale Factor Error with Delta=300 31583
0.05 Scale Factor Error with Delta=300 126332
0.01 Scale Factor Error with Delta=300 3158277
Priority Target DPS
Sample Data visions Priority Target Damage Per Second
Count 11043
Mean 44863.12
Minimum 38471.00
Maximum 54180.87
Spread ( max - min ) 15709.88
Range [ ( max - min ) / 2 * 100% ] 17.51%
Standard Deviation 1923.4602
5th Percentile 41895.68
95th Percentile 48193.12
( 95th Percentile - 5th Percentile ) 6297.44
Mean Distribution
Standard Deviation 18.3037
95.00% Confidence Intervall ( 44827.25 - 44899.00 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 71
0.1% Error 7062
0.1 Scale Factor Error with Delta=300 31583
0.05 Scale Factor Error with Delta=300 126332
0.01 Scale Factor Error with Delta=300 3158277
DPS(e)
Sample Data visions Damage Per Second (Effective)
Count 11043
Mean 44863.12
Minimum 38471.00
Maximum 54180.87
Spread ( max - min ) 15709.88
Range [ ( max - min ) / 2 * 100% ] 17.51%
Damage
Sample Data visions Damage
Count 11043
Mean 13457094.10
Minimum 9872339.11
Maximum 18153848.04
Spread ( max - min ) 8281508.93
Range [ ( max - min ) / 2 * 100% ] 30.77%
DTPS
Sample Data visions Damage Taken Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data visions Healing Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data visions Healing Per Second (Effective)
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data visions Heal
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data visions Healing Taken Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data visions Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data visionsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data visions Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.45 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.46 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 3.77 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 64.78 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 3.65 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 3.11 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 13.74 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
N 11.15 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.79 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 80.16 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 95.81 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.59 sunfire

Sample Sequence

0123456789ACDJNMOHFGJQPJQPJQPQJQPMQPNQPQJOJQPJPPQPQQPJQJQJQPQKPNPJPJQOPQJQMPJQPPQQPJNJPPQJMOQJQLPPPQQJPJPMQQJPOQQJNPQQPJEJMQPQPJPQPQPOQJNQRJQPJPJPQPPQJQPQMNOPJQPQPJHGJQPQJMQPQPIJNJOQPJQPJQPQJQMQPQPQPIJFJLPPJOQPQJMQPPQQPQJQJQJQPNPJMOPJPPQQQJPQJNMPQQJPOQQQPQQJJQPJQPKNPJPPJOQPQQJMPPJPNQJPQPQPQMJJOPPJQPJQPLQPHGJMQPJQJOQPJQPQJQNQPJMQPQPQPJKPJOQPJQLPJPPP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask visions 58.0/100: 58% astral_power
Pre precombat 1 food visions 58.0/100: 58% astral_power
Pre precombat 2 augmentation visions 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.237 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.162 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.088 default O stellar_flare Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.014 default H celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.820 default F berserking Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.820 default G use_items Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.820 default J starsurge Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:05.574 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:06.329 default P lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.197 default J starsurge Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.952 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse
0:08.707 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse
0:09.486 default J starsurge Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.241 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.997 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.752 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.509 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.262 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.017 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.772 default M sunfire Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.525 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.280 default P lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.033 default N moonfire Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.789 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.543 default P lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.315 default Q solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.068 default J starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, torrent_of_elements, overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.824 default O stellar_flare Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.579 default J starsurge Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.333 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.086 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(16), ignition_mages_fuse(5)
0:23.863 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(16), ignition_mages_fuse(5)
0:24.617 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15), ignition_mages_fuse(5)
0:25.489 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14)
0:26.549 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(13)
0:27.303 default P lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12)
0:28.370 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25)
0:29.125 default Q solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24)
0:29.878 default P lunar_strike Fluffy_Pillow 73.5/100: 74% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(24)
0:30.900 default J starsurge Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(23)
0:31.706 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22)
0:32.461 default J starsurge Fluffy_Pillow 71.5/100: 72% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(21)
0:33.216 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20)
0:33.969 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(20)
0:34.722 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(19)
0:35.478 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(18)
0:36.388 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(17)
0:37.144 default K sunfire Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(16)
0:37.897 default P lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(16)
0:38.948 default N moonfire Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(15)
0:39.777 default P lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(14)
0:40.835 default J starsurge Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, arcanic_pulsar(2), solar_empowerment, overwhelming_power(13)
0:41.745 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(12)
0:43.211 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, overwhelming_power(10)
0:44.371 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(9)
0:45.332 default O stellar_flare Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(8)
0:46.466 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(7)
0:47.916 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(2), overwhelming_power(6)
0:48.887 default J starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(5)
0:50.034 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(3)
0:50.990 default M sunfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(3)
0:52.113 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power
0:53.555 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
0:54.691 default Q solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:55.656 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:57.103 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
0:58.550 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
0:59.516 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3)
1:00.482 default P lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3)
1:01.930 default J starsurge Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(6)
1:03.168 default N moonfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord
1:04.371 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord
1:05.573 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:07.063 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2)
1:08.552 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2)
1:09.546 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2)
1:10.715 default M sunfire Fluffy_Pillow 25.0/100: 25% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:11.704 default O stellar_flare Fluffy_Pillow 28.5/100: 28% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:12.694 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:13.534 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
1:14.523 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3)
1:15.363 default L moonfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
1:16.350 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
1:17.798 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers
1:19.246 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
1:20.694 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:21.661 default Q solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar, solar_empowerment, starlord(3), conch_of_dark_whispers
1:22.626 default J starsurge Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar, conch_of_dark_whispers
1:23.862 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
1:25.394 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(2), solar_empowerment, starlord, conch_of_dark_whispers
1:26.597 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:28.085 default M sunfire Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:29.253 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:30.245 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), conch_of_dark_whispers
1:31.240 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(3), starlord(2), overwhelming_power(25)
1:32.308 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24)
1:33.636 default O stellar_flare Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(23)
1:34.680 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(22)
1:35.574 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(21)
1:36.629 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(20)
1:37.687 default N moonfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(19)
1:38.749 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18)
1:40.103 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(16)
1:41.015 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(15)
1:42.093 default P lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), overwhelming_power(14)
1:43.469 default J starsurge Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(5), overwhelming_power(13)
1:44.651 default E potion Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(12), vision_of_perfection
1:44.651 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(12), vision_of_perfection, battle_potion_of_intellect
1:45.635 default M sunfire Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(11), vision_of_perfection, battle_potion_of_intellect
1:46.598 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(10), vision_of_perfection, battle_potion_of_intellect
1:47.419 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(9), vision_of_perfection, battle_potion_of_intellect
1:48.655 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(8), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:49.483 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(7), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:50.728 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(7), celestial_alignment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(6), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:51.711 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(5), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:53.111 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:54.053 default P lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(8), celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(2), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:55.500 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(8), celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power, vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:56.326 default P lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(8), celestial_alignment, starlord(3), torrent_of_elements, vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:57.784 default O stellar_flare Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(8), celestial_alignment, starlord(3), torrent_of_elements, vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:58.758 default Q solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(8), celestial_alignment, starlord(3), torrent_of_elements, vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:59.733 default J starsurge Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
2:00.705 default N moonfire Fluffy_Pillow 69.0/100: 69% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
2:01.681 default Q solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
2:02.509 default R sunfire Fluffy_Pillow 85.5/100: 86% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
2:03.484 default J starsurge Fluffy_Pillow 89.0/100: 89% astral_power celestial_alignment, lunar_empowerment(2), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
2:04.545 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, battle_potion_of_intellect
2:05.436 default P lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord, battle_potion_of_intellect
2:06.769 default J starsurge Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, conch_of_dark_whispers, battle_potion_of_intellect
2:07.817 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
2:09.306 default J starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
2:10.473 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:11.921 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:12.890 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:14.338 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:15.786 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:16.755 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:17.892 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:18.859 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:20.307 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:21.273 default M sunfire Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:22.410 default N moonfire Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
2:23.547 default O stellar_flare Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2)
2:24.786 default P lunar_strike Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2)
2:26.362 default J starsurge Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2)
2:27.602 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord
2:28.625 default P lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord
2:30.155 default Q solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord
2:31.178 default P lunar_strike Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord
2:32.708 default J starsurge Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord
2:33.909 default H celestial_alignment Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2)
2:34.925 default G use_items Fluffy_Pillow 96.0/100: 96% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2)
2:34.925 default J starsurge Fluffy_Pillow 96.0/100: 96% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), ignition_mages_fuse
2:35.900 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), ignition_mages_fuse
2:36.705 default P lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), ignition_mages_fuse
2:37.910 default Q solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse
2:38.714 default J starsurge Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), ignition_mages_fuse
2:39.660 default M sunfire Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
2:40.567 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(2)
2:41.341 default P lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(2)
2:42.498 default Q solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(2)
2:43.270 default P lunar_strike Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(3)
2:44.382 default I cancel_buff Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(3)
2:44.382 default J starsurge Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, torrent_of_elements, ignition_mages_fuse(3)
2:45.336 default N moonfire Fluffy_Pillow 66.0/100: 66% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, ignition_mages_fuse(3)
2:46.260 default J starsurge Fluffy_Pillow 73.5/100: 74% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(25), ignition_mages_fuse(3)
2:47.114 default O stellar_flare Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(24), ignition_mages_fuse(4)
2:47.917 default Q solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(24), ignition_mages_fuse(4)
2:48.669 default P lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(23), ignition_mages_fuse(4)
2:49.695 default J starsurge Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(22), ignition_mages_fuse(4)
2:50.501 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), ignition_mages_fuse(4)
2:51.253 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), ignition_mages_fuse(5)
2:52.225 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), ignition_mages_fuse(5)
2:52.992 default Q solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), ignition_mages_fuse(5)
2:53.747 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18), ignition_mages_fuse(5)
2:54.725 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17), ignition_mages_fuse(5)
2:55.479 default J starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(16), vision_of_perfection
2:56.400 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(15), vision_of_perfection
2:57.186 default M sunfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(14), vision_of_perfection
2:58.112 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(25), vision_of_perfection
2:59.005 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(24), vision_of_perfection
3:00.145 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(23), vision_of_perfection
3:01.043 default P lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(22), vision_of_perfection
3:02.190 default Q solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(21), vision_of_perfection
3:03.094 default P lunar_strike Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(20), vision_of_perfection
3:04.250 default I cancel_buff Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(4), celestial_alignment, starlord(3), overwhelming_power(19), vision_of_perfection
3:04.250 default J starsurge Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(4), celestial_alignment, overwhelming_power(19), vision_of_perfection
3:05.243 default F berserking Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(18)
3:05.243 default J starsurge Fluffy_Pillow 51.0/100: 51% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(18)
3:06.136 default L moonfire Fluffy_Pillow 12.0/100: 12% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(17)
3:07.004 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power berserking, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16)
3:08.283 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power berserking, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(15)
3:09.566 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power berserking, arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(14)
3:10.576 default O stellar_flare Fluffy_Pillow 2.0/100: 2% astral_power berserking, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(13)
3:11.563 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power berserking, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(12)
3:12.406 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power berserking, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11)
3:13.670 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power berserking, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(10)
3:14.516 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power berserking, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9)
3:15.516 default M sunfire Fluffy_Pillow 9.0/100: 9% astral_power berserking, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(8)
3:16.520 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power berserking, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(7)
3:17.376 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(6)
3:18.792 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(5)
3:20.213 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(3)
3:21.168 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(2)
3:22.127 default P lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power
3:23.570 default Q solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3)
3:24.537 default J starsurge Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(8)
3:25.776 default Q solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(25)
3:26.590 default J starsurge Fluffy_Pillow 71.5/100: 72% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(24)
3:27.551 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(23)
3:28.347 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(22)
3:29.285 default Q solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(21)
3:30.065 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(20)
3:31.237 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(19)
3:32.299 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(18)
3:33.654 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(17), conch_of_dark_whispers
3:34.722 default M sunfire Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(16), conch_of_dark_whispers
3:35.794 default O stellar_flare Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(15), conch_of_dark_whispers
3:36.870 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(14), conch_of_dark_whispers
3:38.245 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(12), conch_of_dark_whispers
3:39.334 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers
3:40.726 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10), conch_of_dark_whispers
3:42.120 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(8), conch_of_dark_whispers
3:43.059 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(7), conch_of_dark_whispers
3:44.000 default Q solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(6), conch_of_dark_whispers
3:45.112 default J starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(4), overwhelming_power(5), conch_of_dark_whispers
3:46.327 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(4), conch_of_dark_whispers
3:47.836 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), solar_empowerment, starlord, overwhelming_power(3), conch_of_dark_whispers
3:48.848 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), starlord, overwhelming_power(2)
3:50.041 default N moonfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2)
3:51.210 default M sunfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2)
3:52.379 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(25)
3:53.740 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(24)
3:54.650 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(6), starlord(2), overwhelming_power(23)
3:55.727 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), starlord(2), overwhelming_power(22)
3:56.806 default P lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(21)
3:58.148 default O stellar_flare Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(19)
3:59.208 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(18)
4:00.112 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(17)
4:01.181 default Q solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(16)
4:02.254 default P lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), overwhelming_power(15)
4:03.625 default Q solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(24)
4:04.667 default Q solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(23)
4:05.714 default J starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(7), lunar_empowerment, overwhelming_power(22)
4:06.858 default J starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(24)
4:07.962 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(23)
4:08.759 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(22)
4:09.955 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(21)
4:10.898 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(20)
4:11.682 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(19)
4:12.857 default K sunfire Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(18)
4:13.785 default N moonfire Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(17)
4:14.854 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(16)
4:16.220 default J starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(14)
4:17.299 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(13)
4:18.679 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12)
4:20.066 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(10)
4:21.163 default O stellar_flare Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(9)
4:22.263 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(8)
4:23.201 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7)
4:24.610 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(6)
4:25.552 default Q solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(5)
4:26.498 default J starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(3), lunar_empowerment, overwhelming_power(4)
4:27.718 default M sunfire Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(3)
4:28.908 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(2)
4:30.428 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord
4:31.960 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4), solar_empowerment, starlord
4:33.161 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2)
4:34.651 default N moonfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2)
4:35.819 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2)
4:36.812 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2)
4:37.980 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
4:39.428 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
4:40.396 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3)
4:41.845 default Q solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements
4:42.812 default P lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), torrent_of_elements
4:44.258 default Q solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements
4:45.396 default M sunfire Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements
4:46.532 default J starsurge Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(6), torrent_of_elements
4:47.770 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
4:48.973 default O stellar_flare Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
4:50.141 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
4:51.630 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
4:53.118 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements
4:54.286 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
4:55.126 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24)
4:56.283 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power celestial_alignment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23)
4:57.194 default Q solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(22)
4:57.973 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22)
4:59.135 default L moonfire Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(20)
5:00.056 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(19)
5:00.958 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(19)
5:02.310 default H celestial_alignment Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(17)
5:03.241 default G use_items Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(16)
5:03.241 default J starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(16), ignition_mages_fuse
5:04.136 default M sunfire Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), ignition_mages_fuse
5:05.035 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14), ignition_mages_fuse
5:05.802 default P lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(14), ignition_mages_fuse
5:06.951 default J starsurge Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, overwhelming_power(13), ignition_mages_fuse
5:07.938 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(12), ignition_mages_fuse(2)
5:08.721 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(11), ignition_mages_fuse(2)
5:09.647 default O stellar_flare Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(10), ignition_mages_fuse(2)
5:10.552 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(9), ignition_mages_fuse(2)
5:11.323 default P lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(8), vision_of_perfection, ignition_mages_fuse(3)
5:12.421 default J starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(7), vision_of_perfection, ignition_mages_fuse(3)
5:13.287 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(6), vision_of_perfection, ignition_mages_fuse(3)
5:14.041 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(5), vision_of_perfection, ignition_mages_fuse(3)
5:15.122 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(4), vision_of_perfection, ignition_mages_fuse(3)
5:15.875 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(4), vision_of_perfection, ignition_mages_fuse(4)
5:16.695 default Q solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(3), vision_of_perfection, ignition_mages_fuse(4)
5:17.450 default N moonfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(2), vision_of_perfection, ignition_mages_fuse(4)
5:18.275 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power, vision_of_perfection, ignition_mages_fuse(4)
5:19.105 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), vision_of_perfection, ignition_mages_fuse(4)
5:20.163 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), vision_of_perfection, ignition_mages_fuse(5)
5:20.964 default M sunfire Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), vision_of_perfection, ignition_mages_fuse(5)
5:21.765 default Q solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), ignition_mages_fuse(5)
5:22.521 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(3), ignition_mages_fuse(5)
5:23.554 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(3)
5:24.541 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(3)
5:25.801 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord(3)
5:26.790 default P lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(3)
5:28.049 default J starsurge Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, conch_of_dark_whispers
5:29.126 default K sunfire Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, conch_of_dark_whispers
5:30.172 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, conch_of_dark_whispers
5:31.703 default J starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
5:32.906 default O stellar_flare Fluffy_Pillow 23.5/100: 24% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
5:33.924 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
5:34.790 default P lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), conch_of_dark_whispers
5:36.086 default J starsurge Fluffy_Pillow 58.0/100: 58% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers
5:37.102 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
5:37.944 default L moonfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
5:38.933 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
5:40.381 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers
5:41.517 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
5:42.964 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
5:44.410 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 5.88% 5.88% 500
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="visions"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

worldvein : 40830 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
40830.0 40830.0 23.4 / 0.057% 4887.1 / 12.0% 5014.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 8.0 Astral Power 0.00% 58.4 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
worldvein 40830
Heed My Call 298 (426) 0.7% (1.0%) 8.2 33.01sec 15479 0 Direct 8.2 9127 18261 10834 18.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.24 8.24 0.00 0.00 0.0000 0.0000 89306.27 89306.27 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.70 81.31% 9126.63 8921 9813 9126.28 0 9813 61170 61170 0.00
crit 1.54 18.69% 18260.56 17842 19626 14415.14 0 19626 28136 28136 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 128 0.3% 8.2 33.01sec 4646 0 Direct 8.2 3912 7824 4646 18.8%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.24 8.24 0.00 0.00 0.0000 0.0000 38294.51 38294.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.70 81.24% 3911.59 3823 4206 3910.49 0 4206 26196 26196 0.00
crit 1.55 18.76% 7824.41 7646 8411 6203.13 0 8411 12099 12099 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6030 14.8% 76.8 3.81sec 23536 18132 Direct 76.8 19833 39652 23536 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.76 76.76 0.00 0.00 1.2981 0.0000 1806568.96 1806568.96 0.00 18131.87 18131.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.42 81.32% 19833.17 10135 25993 19841.54 18976 20802 1237911 1237911 0.00
crit 14.34 18.68% 39652.23 20270 51987 39667.71 34720 45488 568658 568658 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2976 7.3% 14.0 21.37sec 63468 62758 Direct 14.0 3423 6850 4067 18.8%  
Periodic 222.9 3151 6300 3742 18.7% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.04 14.04 222.93 222.93 1.0113 1.3310 891229.21 891229.21 0.00 2866.34 62758.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.41 81.23% 3423.30 2981 4364 3425.23 3130 3846 39046 39046 0.00
crit 2.64 18.77% 6850.48 5963 8729 6456.27 0 8729 18059 18059 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.1 81.25% 3151.26 2 4063 3152.69 3057 3283 570803 570803 0.00
crit 41.8 18.75% 6300.46 9 8127 6303.19 5828 6854 263321 263321 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 954 2.3% 44.4 6.57sec 6428 0 Direct 44.4 5418 10824 6428 18.7%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.45 44.45 0.00 0.00 0.0000 0.0000 285699.95 285699.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.14 81.31% 5417.50 4769 6982 5419.49 5036 5919 195788 195788 0.00
crit 8.31 18.69% 10824.16 9539 13963 10827.70 0 13963 89912 89912 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3335 (5333) 8.2% (13.1%) 92.4 3.18sec 17288 19306 Direct 92.9 9063 18111 10752 18.7%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.41 92.92 0.00 0.00 0.8955 0.0000 999067.58 999067.58 0.00 19306.08 19306.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.57 81.33% 9062.80 7949 11636 9068.02 8735 9515 684906 684906 0.00
crit 17.35 18.67% 18110.67 15898 23272 18120.65 16633 20724 314162 314162 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1998 4.9% 73.8 3.96sec 8105 0 Direct 73.8 8105 0 8105 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.85 73.85 0.00 0.00 0.0000 0.0000 598568.33 598568.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.85 100.00% 8105.47 5962 17454 8109.80 7032 9578 598568 598568 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6079.62
  • base_dd_max:6079.62
  • base_dd_mult:1.00
 
Starsurge 14014 34.3% 60.9 4.95sec 68871 66061 Direct 60.7 58236 116267 69087 18.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.92 60.73 0.00 0.00 1.0425 0.0000 4195870.24 4195870.24 0.00 66061.09 66061.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.38 81.30% 58236.36 51347 74359 58262.43 56060 61652 2875668 2875668 0.00
crit 11.35 18.70% 116267.04 102695 148718 116305.51 104566 134301 1320202 1320202 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1928 4.7% 12.7 23.57sec 45302 44179 Direct 12.7 2872 5743 3407 18.6%  
Periodic 220.4 2042 4080 2423 18.7% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.75 12.75 220.44 220.44 1.0255 1.3346 577465.96 577465.96 0.00 1879.32 44179.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.37 81.35% 2872.21 2570 3762 2873.22 2676 3244 29786 29786 0.00
crit 2.38 18.65% 5743.24 5140 7525 5311.53 0 7525 13650 13650 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.3 81.32% 2041.81 4 2634 2042.73 1983 2132 366016 366016 0.00
crit 41.2 18.68% 4080.18 44 5267 4081.80 3849 4600 168014 168014 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5855 14.3% 89.8 3.08sec 19432 0 Direct 89.8 16386 32781 19432 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.76 89.76 0.00 0.00 0.0000 0.0000 1744194.67 1744194.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.08 81.42% 16386.35 16021 17623 16386.37 16021 17299 1197568 1197568 0.00
crit 16.67 18.58% 32781.35 32042 35246 32780.80 32042 34909 546627 546627 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3315 8.1% 18.1 16.50sec 54986 54056 Direct 18.1 4704 9400 5582 18.7%  
Periodic 222.1 3385 6765 4017 18.7% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.06 18.06 222.05 222.05 1.0172 1.3323 992784.96 992784.96 0.00 3159.58 54055.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.68 81.29% 4703.70 4112 6020 4704.04 4360 5099 69033 69033 0.00
crit 3.38 18.71% 9399.82 8225 12040 9161.84 0 12040 31761 31761 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.5 81.29% 3384.69 2 4364 3386.25 3277 3532 610988 610988 0.00
crit 41.5 18.71% 6764.73 5 8729 6767.90 6357 7337 281003 281003 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
worldvein
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.61sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.70sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9024 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Worldvein Resonance 5.5 60.36sec

Stats details: worldvein_resonance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.48 0.00 0.00 0.00 1.1408 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: worldvein_resonance

Static Values
  • id:295186
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295186
  • name:Worldvein Resonance
  • school:physical
  • tooltip:
  • description:Concentrate energy into the Heart of Azeroth, immediately causing {$s1=2} Lifeblood Shards to erupt from the nearby ground for {$295114d=12 seconds}. $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within {$295078s2=8} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.2 53.6 44.3sec 5.0sec 92.80% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.55%
  • arcanic_pulsar_2:10.33%
  • arcanic_pulsar_3:10.98%
  • arcanic_pulsar_4:10.72%
  • arcanic_pulsar_5:13.80%
  • arcanic_pulsar_6:10.62%
  • arcanic_pulsar_7:10.75%
  • arcanic_pulsar_8:14.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 188.6sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.6sec 182.6sec 8.11% 7.76% 0.0(0.0) 2.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.5sec 37.5sec 25.84% 32.61% 0.0(0.0) 8.1

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.0sec 45.6sec 23.70% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.16% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.88%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lifeblood 29.0 0.0 39.7sec 10.5sec 94.48% 0.00% 6.7(7.2) 5.1

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_lifeblood
  • max_stacks:4
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:229.17

Stack Uptimes

  • lifeblood_1:36.01%
  • lifeblood_2:19.88%
  • lifeblood_3:11.44%
  • lifeblood_4:27.15%

Trigger Attempt Success

  • trigger_pct:99.87%

Spelldata details

  • id:295137
  • name:Lifeblood
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by ${$w1+$w2+$w3}.
  • description:{$@spelldesc295078=Every {$s4=18}-{$s1=25} sec, a Lifeblood Shard erupts from the nearby ground for {$295114d=12 seconds}.$?!s295186&a295078[ $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within ${$m2*(1+($295160m1/100))} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.][]}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.1 45.5 8.9sec 3.8sec 81.71% 99.68% 1.8(1.8) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.39%
  • lunar_empowerment_2:31.45%
  • lunar_empowerment_3:13.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.5 64.4sec 33.7sec 47.99% 0.00% 3.5(49.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.92%
  • overwhelming_power_14:1.98%
  • overwhelming_power_15:2.04%
  • overwhelming_power_16:2.10%
  • overwhelming_power_17:2.16%
  • overwhelming_power_18:2.23%
  • overwhelming_power_19:2.30%
  • overwhelming_power_20:2.37%
  • overwhelming_power_21:2.44%
  • overwhelming_power_22:2.52%
  • overwhelming_power_23:2.60%
  • overwhelming_power_24:2.67%
  • overwhelming_power_25:1.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 24.6 51.6 12.0sec 3.9sec 85.46% 79.60% 0.3(0.3) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.17%
  • solar_empowerment_2:39.48%
  • solar_empowerment_3:17.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.7 20.3sec 4.9sec 97.06% 92.04% 15.8(15.8) 11.3

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.80%
  • starlord_2:22.31%
  • starlord_3:59.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 61.2sec 45.9sec 23.54% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.54%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
worldvein
starsurge Astral Power 60.9 2436.9 40.0 40.0 1721.8
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 93.41 747.27 (31.14%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.33%) 40.00 0.00 0.00%
sunfire Astral Power 18.06 54.17 (2.26%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.45 177.78 (7.41%) 4.00 0.01 0.01%
moonfire Astral Power 14.04 42.13 (1.76%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.75 101.98 (4.25%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.76 921.02 (38.38%) 12.00 0.05 0.01%
natures_balance Astral Power 400.36 200.18 (8.34%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.25 74.99 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.00 8.13
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.38 0.00 77.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data worldvein Fight Length
Count 11043
Mean 299.90
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data worldvein Damage Per Second
Count 11043
Mean 40829.97
Minimum 36943.53
Maximum 46058.07
Spread ( max - min ) 9114.54
Range [ ( max - min ) / 2 * 100% ] 11.16%
Standard Deviation 1252.7558
5th Percentile 38857.73
95th Percentile 42975.90
( 95th Percentile - 5th Percentile ) 4118.17
Mean Distribution
Standard Deviation 11.9213
95.00% Confidence Intervall ( 40806.60 - 40853.33 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3617
0.1 Scale Factor Error with Delta=300 13398
0.05 Scale Factor Error with Delta=300 53590
0.01 Scale Factor Error with Delta=300 1339728
Priority Target DPS
Sample Data worldvein Priority Target Damage Per Second
Count 11043
Mean 40829.97
Minimum 36943.53
Maximum 46058.07
Spread ( max - min ) 9114.54
Range [ ( max - min ) / 2 * 100% ] 11.16%
Standard Deviation 1252.7558
5th Percentile 38857.73
95th Percentile 42975.90
( 95th Percentile - 5th Percentile ) 4118.17
Mean Distribution
Standard Deviation 11.9213
95.00% Confidence Intervall ( 40806.60 - 40853.33 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3617
0.1 Scale Factor Error with Delta=300 13398
0.05 Scale Factor Error with Delta=300 53590
0.01 Scale Factor Error with Delta=300 1339728
DPS(e)
Sample Data worldvein Damage Per Second (Effective)
Count 11043
Mean 40829.97
Minimum 36943.53
Maximum 46058.07
Spread ( max - min ) 9114.54
Range [ ( max - min ) / 2 * 100% ] 11.16%
Damage
Sample Data worldvein Damage
Count 11043
Mean 12219050.63
Minimum 9443703.68
Maximum 15065712.58
Spread ( max - min ) 5622008.89
Range [ ( max - min ) / 2 * 100% ] 23.01%
DTPS
Sample Data worldvein Damage Taken Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data worldvein Healing Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data worldvein Healing Per Second (Effective)
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data worldvein Heal
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data worldvein Healing Taken Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data worldvein Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data worldveinTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data worldvein Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
H 5.48 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.91 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.92 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.02 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.78 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.57 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.26 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.75 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 77.12 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 92.67 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.46 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRQKRQKRQRKRQNRQORQRKPKRLQQKRQQRQRRKRKRQRQRMKKNQPRQKRQQKRQQHNKORQKRPQRKQRRNRRRRKOKRQRKQQPKNQRQRRRKKOQQRKQQNRKPQHRRKGQROKRQRKRQNQKQRRPRRKQKQONRQKQRQKQRRRRKPQKNOQRQKRQKHRLQRIEFKRKPRQKORQRQKRQNRQRQMRKKQQRKPRQQNRRKRQRJKRMQKQKQRQNPQHQJKGRKRQKORQQKNRQRRRPRJKKRQKRQLQKORQRQQRRKQKPNRQQKORQKRQHQKRQKNPRQKRQRKRMQRRRKNKQRQKPRQRKQRRRK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask worldvein 58.0/100: 58% astral_power
Pre precombat 1 food worldvein 58.0/100: 58% astral_power
Pre precombat 2 augmentation worldvein 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H worldvein_resonance Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.239 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, lifeblood(3), battle_potion_of_intellect
0:02.191 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:03.117 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:04.042 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:04.966 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:05.773 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:05.773 default G use_items Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:05.773 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:06.527 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:07.281 default Q lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.150 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.905 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.660 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.504 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.258 default R solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.013 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.822 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.578 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.334 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.089 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.868 default N sunfire Fluffy_Pillow 22.5/100: 23% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.621 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.375 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.153 default O moonfire Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.906 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.661 default Q lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.486 default R solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.240 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.994 default P stellar_flare Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.748 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.502 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), ignition_mages_fuse(5)
0:24.257 default L sunfire Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), lifeblood, ignition_mages_fuse(5)
0:25.013 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), lifeblood, ignition_mages_fuse(5)
0:25.951 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(2)
0:27.097 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(2)
0:27.998 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, lifeblood(2)
0:28.753 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(2)
0:29.867 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(2)
0:30.980 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(2)
0:31.733 default Q lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, lifeblood(2)
0:32.848 default R solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(2)
0:33.603 default R solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, lifeblood(2)
0:34.479 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, lifeblood(2)
0:35.356 default R solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, lifeblood(2)
0:36.111 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(2)
0:36.874 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(2)
0:37.630 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, lifeblood(2)
0:38.599 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(2)
0:39.360 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(2)
0:40.330 default R solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, lifeblood(3)
0:41.089 default M moonfire Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
0:42.079 default K starsurge Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar, lunar_empowerment, torrent_of_elements, lifeblood(3)
0:43.316 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, lifeblood(2)
0:44.518 default N sunfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(2)
0:45.686 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(2)
0:47.174 default P stellar_flare Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, lifeblood(2)
0:48.341 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, lifeblood(2)
0:49.336 default Q lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(2)
0:50.828 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(2)
0:51.996 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, lifeblood(2)
0:52.962 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), lifeblood(3)
0:54.409 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(3)
0:55.856 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(3)
0:56.992 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), lifeblood(3)
0:57.958 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(2)
0:59.405 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood
1:00.853 default H worldvein_resonance Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), lifeblood
1:01.989 default N sunfire Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), lifeblood(4)
1:03.128 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(5), solar_empowerment(2), lifeblood(4)
1:04.365 default O moonfire Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord, lifeblood(4)
1:05.569 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord, lifeblood(4)
1:06.590 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, lifeblood(4)
1:08.122 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord, lifeblood(4)
1:09.325 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), lifeblood(4)
1:10.318 default P stellar_flare Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(4)
1:11.487 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(3)
1:12.976 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), lifeblood(3)
1:13.969 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), lifeblood(4)
1:15.136 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
1:16.584 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), lifeblood(4)
1:17.551 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), lifeblood(4)
1:18.516 default N sunfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(8), starlord(3), lifeblood(4)
1:19.653 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(8), starlord(3), lifeblood
1:20.788 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(8), starlord(3), lifeblood
1:21.924 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(8), starlord(3), lifeblood
1:23.060 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(8), starlord(3), lifeblood
1:24.198 default K starsurge Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(8), lifeblood
1:25.437 default O moonfire Fluffy_Pillow 48.5/100: 49% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood
1:26.484 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood
1:27.532 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood
1:28.396 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), lifeblood
1:29.690 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), lifeblood
1:30.555 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), lifeblood
1:31.572 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3)
1:33.020 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3)
1:34.467 default P stellar_flare Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3)
1:35.603 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(25), lifeblood
1:36.643 default N sunfire Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), lifeblood
1:37.687 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), lifeblood
1:39.018 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(21), lifeblood
1:39.912 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(21), lifeblood
1:41.253 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(19), lifeblood
1:42.155 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(18), lifeblood
1:43.220 default R solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(17), lifeblood
1:44.290 default K starsurge Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(3), overwhelming_power(16), lifeblood
1:45.458 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(15), lifeblood
1:46.596 default O moonfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(14), lifeblood(2)
1:47.707 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(13), lifeblood(2)
1:49.127 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(11), lifeblood(2)
1:50.556 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(10), lifeblood(2)
1:51.512 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(9), lifeblood(2)
1:52.643 default Q lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8), lifeblood
1:54.048 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6), lifeblood
1:55.462 default N sunfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(5), lifeblood
1:56.577 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(4), lifeblood
1:57.528 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(3), lifeblood
1:58.653 default P stellar_flare Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2), lifeblood
1:59.784 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power, lifeblood
2:01.228 default H worldvein_resonance Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood
2:02.365 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4)
2:03.333 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
2:04.300 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(7), lifeblood(3)
2:05.538 default G use_items Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, lifeblood(3)
2:05.538 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, lifeblood(3), ignition_mages_fuse
2:07.004 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(8), solar_empowerment, starlord, lifeblood(3), ignition_mages_fuse
2:07.983 default O moonfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), starlord, lifeblood(3), ignition_mages_fuse
2:09.135 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(8), starlord, lifeblood(3), ignition_mages_fuse
2:10.286 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), lifeblood(3), ignition_mages_fuse(2)
2:11.080 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power celestial_alignment, lunar_empowerment(2), starlord(2), lifeblood(4), ignition_mages_fuse(2)
2:12.269 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power celestial_alignment, lunar_empowerment, starlord(2), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.204 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power celestial_alignment, lunar_empowerment, starlord(2), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(2)
2:14.138 default R solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(3)
2:14.893 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.005 default N sunfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.008 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(3)
2:18.286 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, solar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.253 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.483 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), lifeblood, conch_of_dark_whispers, ignition_mages_fuse(4)
2:21.307 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), lifeblood, conch_of_dark_whispers, ignition_mages_fuse(4)
2:22.127 default P stellar_flare Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(2), starlord(3), lifeblood(2), conch_of_dark_whispers, ignition_mages_fuse(5)
2:23.057 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(2), starlord(3), lifeblood(2), conch_of_dark_whispers, ignition_mages_fuse(5)
2:23.988 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(25), lifeblood(2), conch_of_dark_whispers, ignition_mages_fuse(5)
2:24.852 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(2), overwhelming_power(24), lifeblood(2), conch_of_dark_whispers, ignition_mages_fuse(5)
2:25.798 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(23), lifeblood(2), conch_of_dark_whispers
2:27.208 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(3), solar_empowerment, starlord, overwhelming_power(21), lifeblood(2), conch_of_dark_whispers
2:28.323 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(20), lifeblood(2)
2:29.707 default O moonfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19), lifeblood
2:30.802 default N sunfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(18), lifeblood
2:31.896 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(17), lifeblood
2:32.830 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(16), lifeblood
2:34.230 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(14), lifeblood
2:35.341 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13), lifeblood
2:36.721 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12), lifeblood
2:37.645 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(11), lifeblood
2:39.036 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(9), lifeblood(2)
2:40.135 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8), lifeblood
2:41.541 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(7), lifeblood(2)
2:42.482 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6), lifeblood(2)
2:43.427 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(5), lifeblood(2)
2:44.375 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(4), lifeblood(2)
2:45.495 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(6), overwhelming_power(3), lifeblood(2), conch_of_dark_whispers
2:46.719 default P stellar_flare Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(2), lifeblood(2), conch_of_dark_whispers
2:47.912 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power, lifeblood(2), conch_of_dark_whispers
2:49.439 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(7), solar_empowerment, starlord, lifeblood(2), conch_of_dark_whispers
2:50.642 default N sunfire Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(2), conch_of_dark_whispers
2:51.810 default O moonfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(2), conch_of_dark_whispers
2:52.979 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(2), conch_of_dark_whispers
2:54.468 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), lifeblood(2), conch_of_dark_whispers
2:55.461 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), lifeblood(2), conch_of_dark_whispers
2:56.951 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), lifeblood, conch_of_dark_whispers
2:58.119 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood, conch_of_dark_whispers
2:58.961 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), lifeblood, conch_of_dark_whispers
3:00.221 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power celestial_alignment, solar_empowerment(2), starlord(3), lifeblood, conch_of_dark_whispers
3:01.211 default H worldvein_resonance Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), lifeblood, conch_of_dark_whispers
3:02.218 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), lifeblood(4), conch_of_dark_whispers
3:03.059 default L sunfire Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
3:04.049 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
3:05.497 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, solar_empowerment(2), lifeblood(4), conch_of_dark_whispers
3:06.550 default I celestial_alignment Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, lifeblood(4), conch_of_dark_whispers
3:07.628 default E potion Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, lifeblood(4), conch_of_dark_whispers
3:07.628 default F berserking Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:07.628 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:08.607 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:09.416 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:10.366 default P stellar_flare Fluffy_Pillow 15.5/100: 16% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(4), battle_potion_of_intellect
3:11.292 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(4), battle_potion_of_intellect
3:12.081 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), lifeblood(4), battle_potion_of_intellect
3:13.258 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), lifeblood(4), battle_potion_of_intellect
3:14.182 default O moonfire Fluffy_Pillow 6.0/100: 6% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect
3:15.081 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect
3:15.845 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(25), lifeblood(4), battle_potion_of_intellect
3:16.892 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24), lifeblood(4), battle_potion_of_intellect
3:17.647 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(23), lifeblood(4), battle_potion_of_intellect
3:18.701 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power berserking, arcanic_pulsar(4), celestial_alignment, starlord(3), overwhelming_power(22), lifeblood(4), battle_potion_of_intellect
3:19.532 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(21), lifeblood, battle_potion_of_intellect
3:20.287 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(25), lifeblood, battle_potion_of_intellect
3:21.438 default N sunfire Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24), lifeblood, battle_potion_of_intellect
3:22.346 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23), lifeblood, battle_potion_of_intellect
3:23.122 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(22), lifeblood, battle_potion_of_intellect
3:24.286 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(21), lifeblood, battle_potion_of_intellect
3:25.202 default Q lunar_strike Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(20), lifeblood, battle_potion_of_intellect
3:26.374 default M moonfire Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(19), lifeblood, battle_potion_of_intellect
3:27.297 default R solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(18), lifeblood, battle_potion_of_intellect
3:28.205 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar(5), overwhelming_power(17), lifeblood, battle_potion_of_intellect
3:29.371 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(16), lifeblood(2), battle_potion_of_intellect
3:30.506 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(15), lifeblood(2), battle_potion_of_intellect
3:31.918 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24), lifeblood(2), battle_potion_of_intellect
3:33.282 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(2), overwhelming_power(22), lifeblood(3)
3:34.199 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(21), lifeblood(2)
3:35.280 default P stellar_flare Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(20), lifeblood(2)
3:36.338 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(19), lifeblood(2)
3:37.240 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), lifeblood(2)
3:38.597 default Q lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), lifeblood(2)
3:39.957 default N sunfire Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(16), lifeblood(2)
3:41.030 default R solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(24), lifeblood(2)
3:41.916 default R solar_wrath Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(24), lifeblood(2)
3:42.804 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(23), lifeblood(2)
3:43.852 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(22), lifeblood(2)
3:44.630 default Q lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(21), lifeblood(2)
3:45.797 default R solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(25), lifeblood(2)
3:46.704 default J cancel_buff Fluffy_Pillow 96.0/100: 96% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(24), lifeblood(2)
3:46.704 default K starsurge Fluffy_Pillow 96.0/100: 96% astral_power celestial_alignment, lunar_empowerment, overwhelming_power(24), lifeblood(2)
3:47.695 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(23), lifeblood(2)
3:48.513 default M moonfire Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord, overwhelming_power(22), lifeblood(2)
3:49.483 default Q lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar, lunar_empowerment(3), starlord, overwhelming_power(21), lifeblood(2)
3:50.902 default K starsurge Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar, lunar_empowerment(2), starlord, overwhelming_power(20), lifeblood(2)
3:52.021 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(18), lifeblood
3:53.416 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(17), lifeblood
3:54.514 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(16), lifeblood
3:55.879 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(15), lifeblood
3:56.795 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(14), lifeblood
3:58.170 default N sunfire Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(12), lifeblood
3:59.255 default P stellar_flare Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11), lifeblood
4:00.346 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(10), lifeblood
4:01.744 default H worldvein_resonance Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9), lifeblood
4:02.842 default Q lunar_strike Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8), lifeblood(4)
4:04.248 default J cancel_buff Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(6), lifeblood(4)
4:04.248 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(3), solar_empowerment(2), overwhelming_power(6), lifeblood(4)
4:05.460 default G use_items Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(5), lifeblood(4)
4:05.460 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(5), lifeblood(4), ignition_mages_fuse
4:06.422 default K starsurge Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(4), lifeblood(4), ignition_mages_fuse
4:07.556 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(3), lifeblood(4), ignition_mages_fuse
4:08.496 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(2), lifeblood(4), ignition_mages_fuse
4:09.912 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power, lifeblood(4), ignition_mages_fuse(2)
4:10.982 default O moonfire Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), lifeblood(4), ignition_mages_fuse(2)
4:12.027 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), lifeblood(4), ignition_mages_fuse(2)
4:12.915 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(4), ignition_mages_fuse(2)
4:14.245 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4), ignition_mages_fuse(3)
4:15.523 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), lifeblood(4), ignition_mages_fuse(3)
4:16.527 default N sunfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), lifeblood(4), ignition_mages_fuse(3)
4:17.532 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), lifeblood(4), ignition_mages_fuse(4)
4:18.354 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4), ignition_mages_fuse(4)
4:19.585 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3), lifeblood(4), ignition_mages_fuse(4)
4:20.406 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), lifeblood, ignition_mages_fuse(4)
4:21.228 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), lifeblood, ignition_mages_fuse(4)
4:22.049 default P stellar_flare Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(7), starlord(3), ignition_mages_fuse(5)
4:22.980 default R solar_wrath Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(7), starlord(3), ignition_mages_fuse(5)
4:23.910 default J cancel_buff Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(7), starlord(3), ignition_mages_fuse(5)
4:23.910 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(7), ignition_mages_fuse(5)
4:24.922 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, ignition_mages_fuse(5)
4:25.907 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2)
4:26.771 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
4:28.064 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood
4:29.081 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), lifeblood(2)
4:29.923 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(2)
4:31.184 default L sunfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(2)
4:32.171 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(2)
4:33.618 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), lifeblood(3)
4:34.755 default O moonfire Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, lifeblood(3)
4:35.894 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, lifeblood(3)
4:36.860 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(3)
4:38.308 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, lifeblood(3)
4:39.274 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(3)
4:40.721 default Q lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(3)
4:42.168 default R solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(3), torrent_of_elements, lifeblood(3)
4:43.136 default R solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(3)
4:44.101 default K starsurge Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, torrent_of_elements, lifeblood(3)
4:45.339 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, lifeblood(3)
4:46.872 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, lifeblood(2), conch_of_dark_whispers
4:48.077 default P stellar_flare Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, lifeblood(2), conch_of_dark_whispers
4:49.244 default N sunfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(24), lifeblood(2), conch_of_dark_whispers
4:50.318 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(23), lifeblood(2), conch_of_dark_whispers
4:51.233 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(22), lifeblood(2), conch_of_dark_whispers
4:52.607 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21), lifeblood(2), conch_of_dark_whispers
4:53.988 default K starsurge Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(20), lifeblood(3), conch_of_dark_whispers
4:55.075 default O moonfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(18), lifeblood(3), conch_of_dark_whispers
4:56.139 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(17), lifeblood(3), conch_of_dark_whispers
4:57.046 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16), lifeblood(3), conch_of_dark_whispers
4:58.410 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), lifeblood(4), conch_of_dark_whispers
4:59.486 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(14), lifeblood(4), conch_of_dark_whispers
5:00.402 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(13), lifeblood(4), conch_of_dark_whispers
5:01.782 default H worldvein_resonance Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12), lifeblood(4), conch_of_dark_whispers
5:02.870 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11), lifeblood(4)
5:04.260 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(6), solar_empowerment(2), overwhelming_power(9), lifeblood(4)
5:05.459 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(8), lifeblood(4)
5:06.450 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(7), lifeblood(4)
5:07.942 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord, overwhelming_power(6), lifeblood(4)
5:09.117 default N sunfire Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(4), lifeblood(4)
5:10.268 default P stellar_flare Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(3), lifeblood(4)
5:11.424 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(2), lifeblood(4)
5:12.409 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power, lifeblood(4)
5:13.892 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(4)
5:15.061 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, lifeblood(4)
5:15.902 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4)
5:17.162 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power celestial_alignment, solar_empowerment(3), starlord(3), torrent_of_elements, lifeblood(4)
5:18.002 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power celestial_alignment, solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4)
5:18.994 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, lifeblood(4)
5:19.833 default M moonfire Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood
5:20.820 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood
5:22.267 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood
5:23.234 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, lifeblood
5:24.200 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, lifeblood, conch_of_dark_whispers
5:25.335 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar, torrent_of_elements, lifeblood, conch_of_dark_whispers
5:26.574 default N sunfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, lifeblood, conch_of_dark_whispers
5:27.775 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, lifeblood(2), conch_of_dark_whispers
5:28.977 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(2), conch_of_dark_whispers
5:30.464 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), lifeblood(2), conch_of_dark_whispers
5:31.457 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(2), conch_of_dark_whispers
5:32.946 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(2), conch_of_dark_whispers
5:34.116 default P stellar_flare Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, lifeblood, conch_of_dark_whispers
5:35.252 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, lifeblood(2), conch_of_dark_whispers
5:36.219 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(2), conch_of_dark_whispers
5:37.663 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(2), conch_of_dark_whispers
5:38.628 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(2), conch_of_dark_whispers
5:39.765 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(2)
5:41.212 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), lifeblood(2)
5:42.102 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), lifeblood(2)
5:42.996 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, overwhelming_power(22), lifeblood(2)
5:44.046 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, overwhelming_power(20), lifeblood(2)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="worldvein"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

Simulation & Raid Information

Iterations: 11049
Threads: 6
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 299.9 )

Performance:

Total Events Processed: 252658518
Max Event Queue: 321
Sim Seconds: 3313630
CPU Seconds: 315.4375
Physical Seconds: 56.8476
Speed Up: 10505

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
base base augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
base base berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.73sec 0 299.90sec
base base celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.55sec 0 299.90sec
base base flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
base base food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
base base heed_my_call 271685 89361 298 1.65 9128 18254 8.2 8.2 18.8% 0.0% 0.0% 0.0% 32.54sec 89361 299.90sec
base base heed_my_call_aoe 271686 38315 128 1.65 3912 7826 8.2 8.2 18.9% 0.0% 0.0% 0.0% 32.54sec 38315 299.90sec
base base lunar_strike 194153 1770928 5905 15.68 19037 38058 78.4 78.4 18.7% 0.0% 0.0% 0.0% 3.74sec 1770928 299.90sec
base base moonfire 8921 54806 183 2.81 3286 6575 14.1 14.1 18.6% 0.0% 0.0% 0.0% 21.43sec 858202 299.90sec
base base moonfire ticks -8921 803396 2678 44.80 3023 6043 14.1 224.0 18.7% 0.0% 0.0% 0.0% 21.43sec 858202 299.90sec
base base moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
base base potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
base base shooting_stars 202497 275500 919 8.93 5198 10385 44.7 44.7 18.7% 0.0% 0.0% 0.0% 6.58sec 275500 299.90sec
base base solar_wrath 190984 991518 3306 19.25 8689 17368 95.7 96.2 18.6% 0.0% 0.0% 0.0% 3.08sec 991518 299.90sec
base base solar_empowerment 279729 585849 1953 15.09 7766 0 75.4 75.4 0.0% 0.0% 0.0% 0.0% 3.89sec 585849 299.90sec
base base starsurge 78674 4114259 13719 12.39 55999 111874 62.1 61.9 18.7% 0.0% 0.0% 0.0% 4.87sec 4114259 299.90sec
base base stellar_flare 202347 42331 141 2.56 2790 5585 12.8 12.8 18.6% 0.0% 0.0% 0.0% 23.57sec 557509 299.90sec
base base stellar_flare ticks -202347 515179 1717 44.31 1959 3916 12.8 221.6 18.7% 0.0% 0.0% 0.0% 23.57sec 557509 299.90sec
base base streaking_stars 272873 1766714 5891 18.19 16383 32770 90.9 90.9 18.6% 0.0% 0.0% 0.0% 3.06sec 1766714 299.90sec
base base sunfire 93402 94848 316 3.55 4500 8997 17.8 17.8 18.7% 0.0% 0.0% 0.0% 16.86sec 954698 299.90sec
base base sunfire ticks -93402 859850 2866 44.63 3247 6489 17.8 223.1 18.7% 0.0% 0.0% 0.0% 16.86sec 954698 299.90sec
blood of the enemy blood of the enemy augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
blood of the enemy blood of the enemy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.65sec 0 299.90sec
blood of the enemy blood of the enemy blood_of_the_enemy 297108 132462 442 0.74 27661 69194 3.7 3.7 19.8% 0.0% 0.0% 0.0% 91.14sec 132462 299.90sec
blood of the enemy blood of the enemy celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.56sec 0 299.90sec
blood of the enemy blood of the enemy flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
blood of the enemy blood of the enemy food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
blood of the enemy blood of the enemy heed_my_call 271685 94817 316 1.66 9129 18738 8.3 8.3 23.6% 0.0% 0.0% 0.0% 32.83sec 94817 299.90sec
blood of the enemy blood of the enemy heed_my_call_aoe 271686 40605 135 1.66 3912 8037 8.3 8.3 23.5% 0.0% 0.0% 0.0% 32.83sec 40605 299.90sec
blood of the enemy blood of the enemy lunar_strike 194153 1829439 6100 15.62 18961 38950 78.1 78.1 22.4% 0.0% 0.0% 0.0% 3.75sec 1829439 299.90sec
blood of the enemy blood of the enemy moonfire 8921 57249 191 2.81 3273 6798 14.1 14.1 22.7% 0.0% 0.0% 0.0% 21.43sec 911996 299.90sec
blood of the enemy blood of the enemy moonfire ticks -8921 854746 2849 45.25 3009 6321 14.1 226.3 23.2% 0.0% 0.0% 0.0% 21.43sec 911996 299.90sec
blood of the enemy blood of the enemy moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
blood of the enemy blood of the enemy potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
blood of the enemy blood of the enemy shooting_stars 202497 292754 976 9.02 5174 10852 45.1 45.1 23.2% 0.0% 0.0% 0.0% 6.49sec 292754 299.90sec
blood of the enemy blood of the enemy solar_wrath 190984 1027320 3426 19.12 8641 17828 95.1 95.6 22.9% 0.0% 0.0% 0.0% 3.09sec 1027320 299.90sec
blood of the enemy blood of the enemy solar_empowerment 279729 612510 2042 15.04 8149 0 75.2 75.2 0.0% 0.0% 0.0% 0.0% 3.89sec 612510 299.90sec
blood of the enemy blood of the enemy starsurge 78674 4341023 14475 12.35 55684 117688 61.9 61.7 23.6% 0.0% 0.0% 0.0% 4.88sec 4341023 299.90sec
blood of the enemy blood of the enemy stellar_flare 202347 44487 148 2.56 2776 5891 12.8 12.8 22.5% 0.0% 0.0% 0.0% 23.57sec 593334 299.90sec
blood of the enemy blood of the enemy stellar_flare ticks -202347 548847 1829 44.80 1950 4099 12.8 224.0 23.3% 0.0% 0.0% 0.0% 23.57sec 593334 299.90sec
blood of the enemy blood of the enemy streaking_stars 272873 1904554 6351 17.99 16390 34154 89.9 89.9 27.0% 0.0% 0.0% 0.0% 3.09sec 1904554 299.90sec
blood of the enemy blood of the enemy sunfire 93402 99183 331 3.57 4487 9276 17.9 17.9 22.3% 0.0% 0.0% 0.0% 16.76sec 1012074 299.90sec
blood of the enemy blood of the enemy sunfire ticks -93402 912891 3043 45.08 3232 6777 17.9 225.4 23.1% 0.0% 0.0% 0.0% 16.76sec 1012074 299.90sec
focusing iris focusing iris augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
focusing iris focusing iris berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.61sec 0 299.90sec
focusing iris focusing iris celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.43sec 0 299.90sec
focusing iris focusing iris flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
focusing iris focusing iris food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
focusing iris focusing iris heed_my_call 271685 92958 310 1.72 9128 18254 8.6 8.6 18.7% 0.0% 0.0% 0.0% 31.92sec 92958 299.90sec
focusing iris focusing iris heed_my_call_aoe 271686 39844 133 1.72 3912 7826 8.6 8.6 18.7% 0.0% 0.0% 0.0% 31.92sec 39844 299.90sec
focusing iris focusing iris lunar_strike 194153 1845508 6154 16.33 19050 38080 81.6 81.6 18.7% 0.0% 0.0% 0.0% 3.59sec 1845508 299.90sec
focusing iris focusing iris moonfire 8921 55094 184 2.84 3273 6548 14.2 14.2 18.6% 0.0% 0.0% 0.0% 21.29sec 893971 299.90sec
focusing iris focusing iris moonfire ticks -8921 838877 2796 46.72 3027 6049 14.2 233.6 18.7% 0.0% 0.0% 0.0% 21.29sec 893971 299.90sec
focusing iris focusing iris moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
focusing iris focusing iris potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
focusing iris focusing iris shooting_stars 202497 287703 959 9.32 5203 10391 46.6 46.6 18.7% 0.0% 0.0% 0.0% 6.28sec 287703 299.90sec
focusing iris focusing iris solar_wrath 190984 1046329 3489 20.27 8703 17392 100.9 101.3 18.7% 0.0% 0.0% 0.0% 2.93sec 1046329 299.90sec
focusing iris focusing iris solar_empowerment 279729 609893 2034 15.70 7774 0 78.5 78.5 0.0% 0.0% 0.0% 0.0% 3.74sec 609893 299.90sec
focusing iris focusing iris starsurge 78674 4266380 14226 12.84 56037 111971 64.4 64.2 18.6% 0.0% 0.0% 0.0% 4.70sec 4266380 299.90sec
focusing iris focusing iris stellar_flare 202347 42322 141 2.56 2790 5580 12.8 12.8 18.5% 0.0% 0.0% 0.0% 23.56sec 580417 299.90sec
focusing iris focusing iris stellar_flare ticks -202347 538095 1794 46.24 1961 3920 12.8 231.2 18.7% 0.0% 0.0% 0.0% 23.56sec 580417 299.90sec
focusing iris focusing iris streaking_stars 272873 1835008 6119 18.90 16385 32773 94.5 94.5 18.5% 0.0% 0.0% 0.0% 2.97sec 1835008 299.90sec
focusing iris focusing iris sunfire 93402 94134 314 3.53 4498 8995 17.6 17.6 18.7% 0.0% 0.0% 0.0% 17.01sec 991996 299.90sec
focusing iris focusing iris sunfire ticks -93402 897862 2993 46.54 3251 6495 17.6 232.7 18.7% 0.0% 0.0% 0.0% 17.01sec 991996 299.90sec
lucid dreams lucid dreams augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
lucid dreams lucid dreams berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.00sec 0 299.90sec
lucid dreams lucid dreams celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.32sec 0 299.90sec
lucid dreams lucid dreams flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
lucid dreams lucid dreams food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
lucid dreams lucid dreams heed_my_call 271685 91315 304 1.67 9230 18459 8.3 8.3 18.8% 0.0% 0.0% 0.0% 32.70sec 91315 299.90sec
lucid dreams lucid dreams heed_my_call_aoe 271686 39071 130 1.67 3955 7913 8.3 8.3 18.6% 0.0% 0.0% 0.0% 32.70sec 39071 299.90sec
lucid dreams lucid dreams lunar_strike 194153 1758963 5865 15.40 19251 38507 77.0 77.0 18.7% 0.0% 0.0% 0.0% 3.80sec 1758963 299.90sec
lucid dreams lucid dreams memory_of_lucid_dreams 298357 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.16sec 0 299.90sec
lucid dreams lucid dreams moonfire 8921 55343 185 2.84 3289 6573 14.2 14.2 18.6% 0.0% 0.0% 0.0% 21.23sec 873583 299.90sec
lucid dreams lucid dreams moonfire ticks -8921 818240 2727 44.92 3069 6134 14.2 224.6 18.7% 0.0% 0.0% 0.0% 21.23sec 873583 299.90sec
lucid dreams lucid dreams moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
lucid dreams lucid dreams potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
lucid dreams lucid dreams shooting_stars 202497 281207 938 8.98 5275 10543 44.9 44.9 18.8% 0.0% 0.0% 0.0% 6.51sec 281207 299.90sec
lucid dreams lucid dreams solar_wrath 190984 899703 3000 17.16 8839 17671 85.1 85.8 18.7% 0.0% 0.0% 0.0% 3.44sec 899703 299.90sec
lucid dreams lucid dreams solar_empowerment 279729 639517 2132 16.21 7891 0 81.0 81.0 0.0% 0.0% 0.0% 0.0% 3.60sec 639517 299.90sec
lucid dreams lucid dreams starsurge 78674 4894724 16321 14.50 56909 113739 72.8 72.5 18.7% 0.0% 0.0% 0.0% 4.16sec 4894724 299.90sec
lucid dreams lucid dreams stellar_flare 202347 42689 142 2.56 2816 5628 12.8 12.8 18.6% 0.0% 0.0% 0.0% 23.57sec 567669 299.90sec
lucid dreams lucid dreams stellar_flare ticks -202347 524980 1750 44.46 1990 3977 12.8 222.3 18.7% 0.0% 0.0% 0.0% 23.57sec 567669 299.90sec
lucid dreams lucid dreams streaking_stars 272873 1928195 6429 19.57 16619 33235 97.8 97.8 18.6% 0.0% 0.0% 0.0% 2.87sec 1928195 299.90sec
lucid dreams lucid dreams sunfire 93402 94628 316 3.49 4568 9136 17.5 17.5 18.6% 0.0% 0.0% 0.0% 17.13sec 969938 299.90sec
lucid dreams lucid dreams sunfire ticks -93402 875310 2918 44.76 3295 6586 17.5 223.8 18.7% 0.0% 0.0% 0.0% 17.13sec 969938 299.90sec
purification protocol purification protocol augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
purification protocol purification protocol berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.60sec 0 299.90sec
purification protocol purification protocol celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.68sec 0 299.90sec
purification protocol purification protocol flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
purification protocol purification protocol food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
purification protocol purification protocol heed_my_call 271685 89389 298 1.65 9128 18265 8.2 8.2 18.7% 0.0% 0.0% 0.0% 33.00sec 89389 299.90sec
purification protocol purification protocol heed_my_call_aoe 271686 38348 128 1.65 3912 7829 8.2 8.2 18.8% 0.0% 0.0% 0.0% 33.00sec 38348 299.90sec
purification protocol purification protocol lunar_strike 194153 1736984 5792 15.36 19057 38085 76.8 76.8 18.8% 0.0% 0.0% 0.0% 3.81sec 1736984 299.90sec
purification protocol purification protocol moonfire 8921 54619 182 2.81 3281 6550 14.0 14.0 18.6% 0.0% 0.0% 0.0% 21.36sec 853915 299.90sec
purification protocol purification protocol moonfire ticks -8921 799296 2664 44.59 3021 6037 14.0 222.9 18.7% 0.0% 0.0% 0.0% 21.36sec 853915 299.90sec
purification protocol purification protocol moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
purification protocol purification protocol potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
purification protocol purification protocol purification_protocol 295293 222503 742 3.34 11227 22450 16.7 16.7 18.8% 0.0% 0.0% 0.0% 17.30sec 222503 299.90sec
purification protocol purification protocol purifying_blast 295337 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.37sec 0 299.90sec
purification protocol purification protocol purifying_tick ticks -295293 246182 821 0.00 5476 10955 38.0 0.0 18.4% 0.0% 0.0% 0.0% 7.63sec 246182 299.90sec
purification protocol purification protocol shooting_stars 202497 275085 917 8.92 5194 10385 44.6 44.6 18.7% 0.0% 0.0% 0.0% 6.52sec 275085 299.90sec
purification protocol purification protocol solar_wrath 190984 959043 3198 18.59 8698 17385 92.4 92.9 18.7% 0.0% 0.0% 0.0% 3.18sec 959043 299.90sec
purification protocol purification protocol solar_empowerment 279729 573835 1913 14.79 7763 0 73.9 73.9 0.0% 0.0% 0.0% 0.0% 3.96sec 573835 299.90sec
purification protocol purification protocol starsurge 78674 4037650 13463 12.16 55989 111914 60.9 60.8 18.7% 0.0% 0.0% 0.0% 4.94sec 4037650 299.90sec
purification protocol purification protocol stellar_flare 202347 41807 139 2.55 2764 5522 12.8 12.8 18.7% 0.0% 0.0% 0.0% 23.57sec 553950 299.90sec
purification protocol purification protocol stellar_flare ticks -202347 512142 1707 44.09 1958 3912 12.8 220.4 18.7% 0.0% 0.0% 0.0% 23.57sec 553950 299.90sec
purification protocol purification protocol streaking_stars 272873 1744645 5817 17.96 16384 32774 89.8 89.8 18.6% 0.0% 0.0% 0.0% 3.08sec 1744645 299.90sec
purification protocol purification protocol sunfire 93402 96481 322 3.61 4503 9009 18.0 18.0 18.8% 0.0% 0.0% 0.0% 16.50sec 951639 299.90sec
purification protocol purification protocol sunfire ticks -93402 855157 2851 44.41 3245 6484 18.0 222.1 18.7% 0.0% 0.0% 0.0% 16.50sec 951639 299.90sec
ripple in space ripple in space augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
ripple in space ripple in space berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.54sec 0 299.90sec
ripple in space ripple in space celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.62sec 0 299.90sec
ripple in space ripple in space flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
ripple in space ripple in space food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
ripple in space ripple in space heed_my_call 271685 89514 298 1.65 9128 18250 8.3 8.3 18.8% 0.0% 0.0% 0.0% 32.61sec 89514 299.90sec
ripple in space ripple in space heed_my_call_aoe 271686 38313 128 1.65 3911 7825 8.3 8.3 18.7% 0.0% 0.0% 0.0% 32.61sec 38313 299.90sec
ripple in space ripple in space lunar_strike 194153 1779859 5935 15.36 19526 39045 76.8 76.8 18.7% 0.0% 0.0% 0.0% 3.80sec 1779859 299.90sec
ripple in space ripple in space moonfire 8921 56333 188 2.81 3379 6757 14.0 14.0 18.7% 0.0% 0.0% 0.0% 21.37sec 876766 299.90sec
ripple in space ripple in space moonfire ticks -8921 820433 2735 44.58 3101 6200 14.0 222.9 18.7% 0.0% 0.0% 0.0% 21.37sec 876766 299.90sec
ripple in space ripple in space moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
ripple in space ripple in space potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
ripple in space ripple in space ripple_in_space 302731 125626 419 1.09 23095 0 5.5 5.4 0.0% 0.0% 0.0% 0.0% 60.36sec 125626 299.90sec
ripple in space ripple in space shooting_stars 202497 281410 938 8.89 5331 10658 44.5 44.5 18.7% 0.0% 0.0% 0.0% 6.56sec 281410 299.90sec
ripple in space ripple in space solar_wrath 190984 985627 3286 18.58 8945 17877 92.4 92.9 18.7% 0.0% 0.0% 0.0% 3.18sec 985627 299.90sec
ripple in space ripple in space solar_empowerment 279729 590408 1969 14.80 7983 0 74.0 74.0 0.0% 0.0% 0.0% 0.0% 3.96sec 590408 299.90sec
ripple in space ripple in space starsurge 78674 4128313 13765 12.15 57310 114482 60.9 60.7 18.7% 0.0% 0.0% 0.0% 4.95sec 4128313 299.90sec
ripple in space ripple in space stellar_flare 202347 42621 142 2.55 2823 5641 12.7 12.7 18.5% 0.0% 0.0% 0.0% 23.57sec 568037 299.90sec
ripple in space ripple in space stellar_flare ticks -202347 525416 1751 44.08 2009 4017 12.7 220.4 18.7% 0.0% 0.0% 0.0% 23.57sec 568037 299.90sec
ripple in space ripple in space streaking_stars 272873 1744357 5816 17.95 16389 32778 89.7 89.7 18.6% 0.0% 0.0% 0.0% 3.08sec 1744357 299.90sec
ripple in space ripple in space sunfire 93402 98955 330 3.61 4631 9261 18.0 18.0 18.5% 0.0% 0.0% 0.0% 16.52sec 976379 299.90sec
ripple in space ripple in space sunfire ticks -93402 877424 2925 44.40 3331 6658 18.0 222.0 18.7% 0.0% 0.0% 0.0% 16.52sec 976379 299.90sec
unbound force unbound force augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
unbound force unbound force berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.63sec 0 299.90sec
unbound force unbound force celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.72sec 0 299.90sec
unbound force unbound force flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
unbound force unbound force food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
unbound force unbound force heed_my_call 271685 91823 306 1.64 9125 18268 8.2 8.2 22.6% 0.0% 0.0% 0.0% 33.25sec 91823 299.90sec
unbound force unbound force heed_my_call_aoe 271686 39387 131 1.64 3911 7825 8.2 8.2 22.7% 0.0% 0.0% 0.0% 33.25sec 39387 299.90sec
unbound force unbound force lunar_strike 194153 1772286 5910 15.38 19049 38016 76.9 76.9 21.1% 0.0% 0.0% 0.0% 3.80sec 1772286 299.90sec
unbound force unbound force moonfire 8921 56254 188 2.81 3281 6547 14.0 14.0 22.3% 0.0% 0.0% 0.0% 21.36sec 879511 299.90sec
unbound force unbound force moonfire ticks -8921 823258 2744 44.60 3024 6025 14.0 223.0 22.2% 0.0% 0.0% 0.0% 21.36sec 879511 299.90sec
unbound force unbound force moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
unbound force unbound force potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
unbound force unbound force shooting_stars 202497 283110 944 8.90 5199 10356 44.5 44.5 22.5% 0.0% 0.0% 0.0% 6.54sec 283110 299.90sec
unbound force unbound force solar_wrath 190984 982755 3277 18.69 8694 17367 92.9 93.4 21.0% 0.0% 0.0% 0.0% 3.16sec 982755 299.90sec
unbound force unbound force solar_empowerment 279729 586491 1956 14.81 7923 0 74.0 74.0 0.0% 0.0% 0.0% 0.0% 3.96sec 586491 299.90sec
unbound force unbound force starsurge 78674 4138597 13800 12.18 56005 111632 61.1 60.9 21.5% 0.0% 0.0% 0.0% 4.94sec 4138597 299.90sec
unbound force unbound force stellar_flare 202347 42963 143 2.55 2767 5525 12.7 12.7 21.9% 0.0% 0.0% 0.0% 23.57sec 570026 299.90sec
unbound force unbound force stellar_flare ticks -202347 527063 1757 44.11 1959 3905 12.7 220.5 22.1% 0.0% 0.0% 0.0% 23.57sec 570026 299.90sec
unbound force unbound force streaking_stars 272873 1764152 5882 17.85 16387 32787 89.2 89.2 20.7% 0.0% 0.0% 0.0% 3.10sec 1764152 299.90sec
unbound force unbound force sunfire 93402 99415 331 3.61 4508 8984 18.1 18.1 22.2% 0.0% 0.0% 0.0% 16.50sec 979998 299.90sec
unbound force unbound force sunfire ticks -93402 880582 2935 44.43 3248 6472 18.1 222.1 22.2% 0.0% 0.0% 0.0% 16.50sec 979998 299.90sec
unbound force unbound force the_unbound_force ticks -298452 402497 1342 7.86 1595 8208 4.9 39.3 76.9% 0.0% 0.0% 0.0% 67.60sec 402497 299.90sec
visions visions augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
visions visions berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 190.41sec 0 299.90sec
visions visions celestial_alignment 194223 0 0 0.00 0 0 2.5 0.0 0.0% 0.0% 0.0% 0.0% 149.41sec 0 299.90sec
visions visions flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
visions visions food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
visions visions heed_my_call 271685 92011 307 1.68 9222 18449 8.4 8.4 18.7% 0.0% 0.0% 0.0% 32.85sec 92011 299.90sec
visions visions heed_my_call_aoe 271686 39467 132 1.68 3952 7906 8.4 8.4 18.8% 0.0% 0.0% 0.0% 32.85sec 39467 299.90sec
visions visions lunar_strike 194153 1854233 6183 15.97 19564 39113 79.8 79.8 18.7% 0.0% 0.0% 0.0% 3.67sec 1854233 299.90sec
visions visions moonfire 8921 56560 189 2.85 3340 6681 14.3 14.3 18.7% 0.0% 0.0% 0.0% 21.21sec 899604 299.90sec
visions visions moonfire ticks -8921 843044 2810 45.63 3115 6226 14.3 228.2 18.7% 0.0% 0.0% 0.0% 21.21sec 899604 299.90sec
visions visions moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
visions visions potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
visions visions shooting_stars 202497 289468 965 9.12 5355 10702 45.6 45.6 18.6% 0.0% 0.0% 0.0% 6.41sec 289468 299.90sec
visions visions solar_wrath 190984 1024360 3416 19.23 8990 17972 95.6 96.1 18.6% 0.0% 0.0% 0.0% 3.09sec 1024360 299.90sec
visions visions solar_empowerment 279729 628230 2095 15.67 8020 0 78.3 78.3 0.0% 0.0% 0.0% 0.0% 3.75sec 628230 299.90sec
visions visions starsurge 78674 4418702 14734 12.91 57754 115453 64.8 64.5 18.6% 0.0% 0.0% 0.0% 4.67sec 4418702 299.90sec
visions visions stellar_flare 202347 43144 144 2.56 2844 5694 12.8 12.8 18.5% 0.0% 0.0% 0.0% 23.56sec 583714 299.90sec
visions visions stellar_flare ticks -202347 540569 1802 45.15 2019 4035 12.8 225.7 18.7% 0.0% 0.0% 0.0% 23.56sec 583714 299.90sec
visions visions streaking_stars 272873 2626629 8758 26.74 16563 33131 133.7 133.7 18.6% 0.0% 0.0% 0.0% 2.15sec 2626629 299.90sec
visions visions sunfire 93402 98700 329 3.60 4627 9253 18.0 18.0 18.6% 0.0% 0.0% 0.0% 16.69sec 1000677 299.90sec
visions visions sunfire ticks -93402 901977 3007 45.46 3345 6687 18.0 227.3 18.7% 0.0% 0.0% 0.0% 16.69sec 1000677 299.90sec
worldvein worldvein augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
worldvein worldvein berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.61sec 0 299.90sec
worldvein worldvein celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.70sec 0 299.90sec
worldvein worldvein flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
worldvein worldvein food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
worldvein worldvein heed_my_call 271685 89306 298 1.65 9127 18261 8.2 8.2 18.7% 0.0% 0.0% 0.0% 33.01sec 89306 299.90sec
worldvein worldvein heed_my_call_aoe 271686 38295 128 1.65 3912 7824 8.2 8.2 18.8% 0.0% 0.0% 0.0% 33.01sec 38295 299.90sec
worldvein worldvein lunar_strike 194153 1806569 6024 15.36 19833 39652 76.8 76.8 18.7% 0.0% 0.0% 0.0% 3.81sec 1806569 299.90sec
worldvein worldvein moonfire 8921 57105 190 2.81 3423 6850 14.0 14.0 18.8% 0.0% 0.0% 0.0% 21.37sec 891229 299.90sec
worldvein worldvein moonfire ticks -8921 834124 2780 44.59 3151 6300 14.0 222.9 18.7% 0.0% 0.0% 0.0% 21.37sec 891229 299.90sec
worldvein worldvein moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
worldvein worldvein potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
worldvein worldvein shooting_stars 202497 285700 953 8.89 5418 10824 44.4 44.4 18.7% 0.0% 0.0% 0.0% 6.57sec 285700 299.90sec
worldvein worldvein solar_wrath 190984 999068 3331 18.59 9063 18111 92.4 92.9 18.7% 0.0% 0.0% 0.0% 3.18sec 999068 299.90sec
worldvein worldvein solar_empowerment 279729 598568 1996 14.77 8105 0 73.8 73.8 0.0% 0.0% 0.0% 0.0% 3.96sec 598568 299.90sec
worldvein worldvein starsurge 78674 4195870 13991 12.15 58236 116267 60.9 60.7 18.7% 0.0% 0.0% 0.0% 4.95sec 4195870 299.90sec
worldvein worldvein stellar_flare 202347 43436 145 2.55 2872 5743 12.7 12.7 18.6% 0.0% 0.0% 0.0% 23.57sec 577466 299.90sec
worldvein worldvein stellar_flare ticks -202347 534030 1780 44.09 2042 4080 12.7 220.4 18.7% 0.0% 0.0% 0.0% 23.57sec 577466 299.90sec
worldvein worldvein streaking_stars 272873 1744195 5816 17.96 16386 32781 89.8 89.8 18.6% 0.0% 0.0% 0.0% 3.08sec 1744195 299.90sec
worldvein worldvein sunfire 93402 100794 336 3.61 4704 9400 18.1 18.1 18.7% 0.0% 0.0% 0.0% 16.50sec 992785 299.90sec
worldvein worldvein sunfire ticks -93402 891991 2973 44.41 3385 6765 18.1 222.1 18.7% 0.0% 0.0% 0.0% 16.50sec 992785 299.90sec
worldvein worldvein worldvein_resonance 295186 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.36sec 0 299.90sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
351943.9 0.0 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 13.47% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:13.47%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 8.58% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.58%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.47% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.47%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 9.19% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:9.19%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.38% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.38%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.72% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.72%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 12.14% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:12.14%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.79% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.79%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 7.07% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:7.07%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.19% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.19%

Trigger Attempt Success

  • trigger_pct:100.00%
Blood of the Enemy 2.0 0.0 182.8sec 182.8sec 6.76% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_blood_of_the_enemy
  • max_stacks:1
  • duration:10.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • blood_of_the_enemy_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297108
  • name:Blood of the Enemy
  • tooltip:You have a $w2% increased chance to be Critically Hit by the caster.
  • description:The Heart of Azeroth erupts violently, dealing $s1 Shadow damage to enemies within $A1 yds. You gain $m2% critical strike chance against the targets for {$d=10 seconds}$?a297122[, and increases your critical hit damage by $297126m% for {$297126d=5 seconds}][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 351943.90
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 11043
Mean 299.90
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 11043
Mean 377032.19
Minimum 357197.91
Maximum 399921.40
Spread ( max - min ) 42723.49
Range [ ( max - min ) / 2 * 100% ] 5.67%
Standard Deviation 7040.0905
5th Percentile 366047.36
95th Percentile 388523.11
( 95th Percentile - 5th Percentile ) 22475.75
Mean Distribution
Standard Deviation 66.9938
95.00% Confidence Intervall ( 376900.88 - 377163.49 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1340
0.1 Scale Factor Error with Delta=300 423098
0.05 Scale Factor Error with Delta=300 1692389
0.01 Scale Factor Error with Delta=300 42309720
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 11043
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 2076
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 120867926 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 2700 2700 2700
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

\n\n